Entry information : CgrayGPx01
Entry ID 10072
Creation 2012-01-04 (Passaia Gisèle)
Last sequence changes 2012-01-04 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: CgrayGPx01
Name CgrayGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Lecanoromycetes Cladoniaceae Cladonia
Organism Cladonia grayi    [TaxId: 27339 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgrayGPx01
start..stop
S start..stop
CgGPx01 276 7.03e-95 3..209 24..236
AteGPx 273 8.86e-95 43..211 1..169
MrubGPx01 274 8.93e-95 43..215 1..172
VaaGPx01 276 1.01e-94 17..207 48..235
Gene structure Fichier Exons


exon

Literature and cross-references CgrayGPx01
DNA ref. JGI genome:   scaffold_6 (410965..410193)
Protein sequence: CgrayGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219 (300)
PWM (Da):   %s   24632.75 (32302.1)  
PI (pH):   %s   9.48 (4.80) Peptide Signal:   %s   cut: 30 range:30-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQSTLLLPQATTSICLRPRYSSISKSFFSPISSRLRPVRSYTMASATSFYDFEPLDKKGQPYPLSSLKNKVVLIVNTASKCGFTPQFEGLETLYKKIKEKYPDDFIILGFPCNQFMNQDP
GDNDTIQSFCQLNYGVTFPILSKLDVNGPAASPLFEYLKANAPGLFGLKRVKWNFEKFLVGRDGEVKTRWASTTKPEALEGRILEELKKGESEKGKSEL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_6:409939-410899 (-), 2 introns) NO EST. Strain "Cgr/DA2myc/ss"
DNA
Send to BLAST
CDS
Send to BLAST