Entry information : GtraGPx01
Entry ID 10076
Creation 2012-01-04 (Passaia Gisèle)
Last sequence changes 2012-01-04 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: GtraGPx01
Name GtraGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Gloeophyllaceae Gloeophyllum
Organism Gloeophyllum trabeum    [TaxId: 104355 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GtraGPx01
start..stop
S start..stop
NlepGPx01 332 3.42e-117 1..221 1..217
PstrGPx01 309 6.87e-108 49..220 87..254
PplGPx02 295 2.48e-102 22..220 37..236
PcriGPx01 293 6.31e-102 1..221 1..230
Gene structure Fichier Exons


exon

Literature and cross-references GtraGPx01
DNA ref. JGI genome:   scaffold_00012 (1369495..1370383)
Protein sequence: GtraGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220 (305)
PWM (Da):   %s   24712.89 (32452.1)  
PI (pH):   %s   10.17 (4.91) Peptide Signal:   %s   cut: 27 range:27-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNRRLPWVSSFINRSRYSVGNLALRSFARHIAPRRLPSIHLPASLLYSRTIATARDSEPKMVESFYELKAEMPGGKVYDFADLKGKVVLIVNTASQCGFTPQYKGLQKLYEKFKDKGFVI
LGFPCNQFGGQEPGDDKAISEFCTLNHGVTFPLMKKSDVNGDNTNEVFKWLKSQKAGILGLTRIKWNFEKFLIDKNGNVVSRWASTTSPDAIDAEVAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_00012, 4 introns). No EST.
DNA
Send to BLAST
CDS
Send to BLAST