Entry information : TterGPx01
Entry ID 10102
Creation 2012-01-05 (Passaia Gisèle)
Last sequence changes 2016-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-08 (Achraf Jemmat)
Peroxidase information: TterGPx01
Name TterGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Thielavia
Organism Thielavia terrestris (Acremonium alabamense)    [TaxId: 35720 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TterGPx01
start..stop
S start..stop
CgGPx01 325 3.34e-114 5..232 10..236
StheGPx01 325 5.97e-114 19..233 23..238
ChigGPx01 313 1.62e-109 25..232 12..239
CgraGPx01 311 1.07e-108 64..230 67..233
Gene structure Fichier Exons


exon

Literature and cross-references TterGPx01
DNA ref. JGI genome:   chromosome_1 (2185506..2184745)
Cluster/Prediction ref. JGI gene:   2107313
Protein sequence: TterGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232
PWM (Da):   %s   25763.53  
PI (pH):   %s   9.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVINLSPKIPPLVPFICPSATAKVATVTACRTALRLHLPTPWHTSPRPIYLKLKPQVTLHRAFAAMASATTFYDFKPLDKRGNEVPLSDYKGKVVLVVNTASKCGFTPQYAGLEKLYKSV
REKHGDNFVILGFPCNQFGNQEPGSNEEIQQFCQVNYGVTFPIMAKVDVNGDNASPLFQWLKAQQPGILGLKRVKWNFEKFLVGKDGTVKGRWASTTKPESLESTILEELAK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 1 intron). No EST. Incorrect prediction from JGI (5' end is missing).
DNA
Send to BLAST
CDS
Send to BLAST