1. Browse the Database
  2. View Redoxidase
Entry information : BbotDyPrx01
Entry ID 10215
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: BbotDyPrx01
Name BbotDyPrx01
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Botryobasidiaceae Botryobasidium
Organism Botryobasidium botryosum    [TaxId: 264124 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BbotDyPrx01
start..stop		 S start..stop
FmeDyPrx01 371 3.86e-125 6..477 1..468
FmeDyPrx03 371 6.06e-125 15..478 6..473
BaDyPrx02 371 1.19e-124 16..478 59..495
ShirDyPrx02 369 1.2e-123 6..477 1..485
Gene structure Fichier Exons►


exon

Literature and cross-references BbotDyPrx01
DNA ref. JGI genome:   scaffold_48 (163983..165937)
Cluster/Prediction ref. JGI gene:   147513
Protein sequence: BbotDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   479 (303)
PWM (Da):   %s   53765.43 (32162.7) Transmb domain:   %s   o218-240i
PI (pH):   %s   6.36 (4.53) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEIHLDTPDIPHPPLDLSNIQGDILRGFAKDTETFLFFRITDPAEFRSRLQHIIPLITTAKQCEEIRQKIQAFRHSKEYKPGERLPITELNVAFSARGLEVLGITDDLGDEEFKKGQYADAEDLGDVIEWDDIYTQTIHGVFLV
ASNSPSGIEMLIAKVQSSLGDSIETMAKVSGSVRPGDQRSHEFGFKDGISRPNIIGYTDPIYPGPKPILPGVILLGNVGDVQEINPPVHKERPAWAKDGSFLAFRHLQQLVPEYNRWLLK
EATRLFPWIPSKGEVGSAAELLGARTFGRWKSGCPLSHSWHKDDPDIANDPQKNNNFDFGEDSGQTRLPFAAHIRKMMPRSNQPPDRLPFQQIVRAGIPYGPEVDKETEEESTVHDRGLL
FVCYQSHLGNRRGFSFIQLWANDPKFPRIESSVPGLDLICGQKGDLDRTMTGLHQNQQERESIAPRFVVSKGGEYFFSPSLALREKFATS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST