Entry information : PinvHalPrx04
Entry ID 10815
Creation 2012-04-13 (Christophe Dunand)
Last sequence changes 2012-04-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-13 (Christophe Dunand)
Peroxidase information: PinvHalPrx04
Name PinvHalPrx04
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Paxillaceae Paxillus
Organism Paxillus involutus    [TaxId: 71150 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PinvHalPrx04
start..stop
S start..stop
SlutHalPrx04 305 4.12e-106 4..223 2..223
SbreHalPrx04 304 7.86e-106 4..223 2..223
SbreHalPrx03 166 2.76e-51 9..220 29..243
SlutHalPrx03 165 5.2e-51 10..220 26..239
Gene structure Fichier Exons


exon

Literature and cross-references PinvHalPrx04
DNA ref. JGI genome:   scaffold_7 (1441299..1440561)
Cluster/Prediction ref. JGI gene:   110845
Protein sequence: PinvHalPrx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   225
PWM (Da):   %s   24440.21 Transmb domain:   %s   i59-81o
PI (pH):   %s   6.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTASQNYSTPPFVPASQGDKRSPCPALNALANHGYLPHDGKNIGLWQLIHAMRSVYNLSFPLAALLALAGVLFCGHAMQLDLDSLAMHNKIEHDASLVHGDALAGHATAPIPVDPDLLH
SFLSHANQQDGMSLGGFARVRVDREARLTSPLDHLHSEIGTGEAALCWLLLKKDNGQVPLSTLEQWYGQERIPDDWAPPASGVGIFDARRKANEVAEMMQQMKSR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
CDS
Send to BLAST