1. Browse the Database
  2. View Redoxidase
Entry information : OsPrx98(LOC_Os07g02440)
Entry ID 1108
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx98(LOC_Os07g02440)
Name OsPrx98(LOC_Os07g02440)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx98
start..stop		 S start..stop
SiPrx125 509 0 26..330 23..328
HvPrx35 504 0 13..330 9..326
TaPrx188-1D 500 3.05e-180 25..330 18..323
TaPrx188-1B 496 1.43e-178 25..330 18..323
Gene structure Fichier Exons►


exon

Literature and cross-references OsPrx98(LOC_Os07g02440)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q8H2P0
DNA ref. GenBank:   NC_008400.1 (837248..839885)
Protein sequence: OsPrx98(LOC_Os07g02440)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (300)
PWM (Da):   %s   34682.45 (31649.9) Transmb domain:   %s   i13-32o
PI (pH):   %s   8.98 (8.57) Peptide Signal:   %s   cut: 31 range:31-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMVVVMRRRMAAAAMLVLVAMAGGATVCAAQLRRNYYAGVCPNVE
SIVRGAVARKVQETFATVGATVRLFFHDCFVDGCDASVVVASAGNNTAEKDHPNNLSLAGDGFDTVIKAKAAVDA
VPGCRDRVSCADILAMATRDAIALAGGPSYAVELGRLDGLRSTASSVNGRLPPPTFNLDQLTALFAANGLSQADMIALSAGHTVGFAHCNTFLGRIRGSSVDPTMSPRYAAQLQRSCPPN
VDPRIAVTMDPVTPRAFDNQYFKNLQNGMGLLGSDQVLYSDPRSRPIVDSWAQSSAAFNQAFVTAMTKLGRVGVKTGSQGNIRRNCAVLN

Retrieve as FASTA  
Remarks chromosome 7. No ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST