1. Browse the Database
  2. View Redoxidase
Entry information : Tmel2CysPrx
Entry ID 11115
Creation 2012-06-05 (Christophe Dunand)
Last sequence changes 2012-06-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-05 (Christophe Dunand)
Peroxidase information: Tmel2CysPrx
Name Tmel2CysPrx
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Ascomycota Pezizomycetes Tuberaceae Tuber
Organism Tuber melanosporum    [TaxId: 39416 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Tmel2CysPrx
start..stop		 S start..stop
Pno2CysPrx 303 3.09e-106 3..196 10..205
Yl2CysPrx 301 7.84e-106 1..195 1..195
Dh2CysPrx 291 3.58e-102 1..195 1..195
Cal2CysPrx01 289 3.86e-101 1..195 1..195
Gene structure Fichier Exons►


exon

Literature and cross-references Tmel2CysPrx
Protein ref. UniProtKB:   D5GI33
DNA ref. JGI genome:   scaffold_43 (730431..731467)
Cluster/Prediction ref. JGI gene:   4995
Protein sequence: Tmel2CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196
PWM (Da):   %s   21560.02  
PI (pH):   %s   4.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVARVQHPAPPFKGTAVVEGGFEEISLKDYEGKWLILGFIPMAWTFVCPTIIAFSDAAKSFEERGASIVFASVDSEYSLLAWSSTERKDGGLGNINIPLFSDKNHKLAGDYGVLIEEEGV
ALRGLFIIDPKGTIRITINDLPVGRSVDETLRLVDAFKFTEKYGEVCPANWNQGGETIKANPKESKEYFNKVHG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST