Entry information : OsPrx102(LOC_Os07g31610)
Entry ID 1112
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: OsPrx102(LOC_Os07g31610)
Name OsPrx102(LOC_Os07g31610)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Pannicles
Seedling roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx102
start..stop
S start..stop
TaPrx189-1D 441 1.37e-156 3..345 2..335
TaPrx189-1A 441 2.99e-156 3..345 2..335
TaPrx189-1B 438 1.78e-155 3..345 2..335
BdiPrx17 401 1.32e-140 3..345 4..347
Gene structure Fichier Exons


exon

Literature and cross-references OsPrx102(LOC_Os07g31610)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1J1
DNA ref. GenBank:   NC_008400.1 (18712145..18713393)
Cluster/Prediction ref. UniGene:   Os.55785
Protein sequence: OsPrx102(LOC_Os07g31610)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (319)
PWM (Da):   %s   37504.12 (34701.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.37 (6.91) Peptide Signal:   %s   cut: 31 range:31-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTRTPASLSLAVVAVSVAAAALLLAALVAADGQKQQGYVQPAYRR
PAAGLKADYYHQSCPDMEGIVQRAVKKAIAADSTLAPALLRLFFHDFAVG
GIDASVLVDSPGSERYAKASKTLRGFELIESIKAELEAKCPKTVSCADILAAAARDASTEVKVDYWPLMYGRKDGRRSSMVDADQYVPMGRESVTDLIAFFESRGLTVLDLAVLSGAHTI
GRATCAAVKPRLWDYAGTGRPDASMSPRYGDFLRRKCAAAGDGGYVYLDADTPTEFDNGYYKNLLRDMGLLETDQKLLPDSRTGEFVRELAGARPELIRHQFADSMRRLGAAQVLTGDEG
EVRLKCSAINSNSY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, introns 1 and 2) and 4 ESTs. Missing 'c'. containing motif fhdf.
DNA
Send to BLAST
CDS
Send to BLAST