Entry information : EguPrx115
Entry ID 11190
Creation 2012-07-10 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx115
Name EguPrx115
Class Class III peroxidase    [Orthogroup: Prx116]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx115
start..stop
S start..stop
EcamPrx115 662 0 1..322 1..322
EgrPrx115 656 0 1..322 1..322
EglPrx115 653 0 1..322 1..322
EgrPrx116 597 0 1..322 1..321
Gene structure Fichier Exons


exon

Literature and cross-references EguPrx115
Literature Identification of 8050 cDNAs from a normalized Eucalyptus xylem full-length RT cDNA library, Sivadon,P., Ladouce,N., Wincker,P., Couloux,A., San Clemente,H. and Grima-Pettenati,J. Unpublished (2006).
EST ref. GenBank:   CU398989.1
Protein sequence: EguPrx115
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   34361.05 (31880.7)  
PI (pH):   %s   7.31 (6.97) Peptide Signal:   %s   cut: 27 range:27-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSSFSKAVLTLACVVLLVGGTSAQLSIYHYAETCPQLCPTVKSIVQAEIAKEARMGASLLRLFFHDCFVNGCDGSNLLDDTPTFTGEKNAAPNRNSLRGFEVVDKIKxAVENVCPGV
VSCADLxAIISRDAVEILGGPGWDVKLGRRDARTASQAAANNSIPPPTDSLNALISGFQNHGLSQKDLVALYGAHTVGQARCTNFRARIYNESNIDSSFAQAMKSNCPSVNGVGDNNLDG
LDFQSATSFDNTYYINLMRKRGLLHSDQQLFNGGSTDSLIRTYAQSQETFFKDFVASMINMGDIKPLTGSNGEIRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic and EST. Scaffold_7_25755 (36545..38631) .
DNA
Send to BLAST
CDS
Send to BLAST