Entry information : OsPrx119(LOC_Os08g42030)
Entry ID 1129
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-10 (Christophe Dunand)
Peroxidase information: OsPrx119(LOC_Os08g42030)
Name OsPrx119(LOC_Os08g42030)
Class Class III peroxidase    [Orthogroup: Prx031]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Pannicles
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx119
start..stop
S start..stop
TaPrx109-1B 486 1.87e-174 7..339 1..333
BdiPrx111 483 1.86e-173 7..339 1..335
TaPrx109-1A 479 8.52e-172 7..339 1..333
TaPrx109-1D 478 2.66e-171 7..339 1..333
Gene structure Fichier Exons


exon

Literature and cross-references OsPrx119(LOC_Os08g42030)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q6YZD5
DNA ref. GenBank:   NC_008401.1 (26542488..26540015)
Protein sequence: OsPrx119(LOC_Os08g42030)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339
PWM (Da):   %s   36181.89 Transmb domain:   %s   i13-35o
PI (pH):   %s   5.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFSSSAMERRRRSPCAAVVMAAVAMLAVMPAFPGVAADLSAGYYSSSCPKLESIVRYEVSRKINETVVTIPAVLRLFFHDCLVTGCDASALISSPNDDAEKDAPDNMSLAGDGFDTVNRV
KTAVEKACPGVVSCADILALAARDVVSL
ASGPWWSVELGRLDGLVSKASDVDGKLPGPDMRVTKLAAVFDKHGLSMRDMVALSGAHTVGFAHCTRFTGRLYNYSAGEQTDPSMNKDYAAQ
LMEACPRDVGKTIAVNMDPVSPIVFDNVYYSNLVNGLGLFTSDQVLYTDGASRRTVEEFAVNQTAFFDAFVSSMVRLGRLGVKAGKDGEVRRDCTAFNH*

Retrieve as FASTA  
Remarks chromosome 8. 2 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST