Entry information : ZmaPrx04 ( Zosma123g00700 [2.2])
Entry ID 11488
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-04-07 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-04-07 (Achraf Jemmat)
Peroxidase information: ZmaPrx04 ( Zosma123g00700 [2.2])
Name (synonym) ZmaPrx04 ( Zosma123g00700 [2.2])
Class Class III peroxidase    [Orthogroup: Prx292]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Zosteraceae Zostera
Organism Zostera marina    [TaxId: 29655 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmaPrx04
start..stop
S start..stop
ZmaPrx05 594 0 1..316 1..316
ZmaPrx20 496 5.57e-179 1..315 1..318
PotacuPrx34 461 6.17e-165 21..315 29..325
ZmaPrx[P]44 429 1.64e-152 1..315 1..315
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11488' 'join(405641..405844,405942..406133,406313..406867)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 405641..405844 202 N° 2 405942..406133 190 N° 3 406313..406867 553  
join(405641..405844,405942..406133,406313..406867)


exon

Literature and cross-references ZmaPrx04 ( Zosma123g00700 [2.2])
DNA ref. Phytozome 12:   scaffold_123 (405641..406867)
Protein sequence: ZmaPrx04 ( Zosma123g00700 [2.2])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   34545.87 (32243.6)  
PI (pH):   %s   9.03 (9.19) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSFESAILIALLLPLTTSALSSNYYSKSCPNLFKVVYPVIAKAIKQQPRNGASILRLFFHDCFVNGCDGSILLDDTPTFTGEKTAFPNLNSVRGFNVIDDVKAAVEDACSGVVSCAD
ILAIASLDAVYILGGPWWKLKLGRLDARTASRDLANKNLPAPSLNLKGLKTAFKNVGLSEKDVVVLSGGHTIGLARCVTFRNHIYNDTDIDPKFAANRQKTCPRSGGNNNLAPLDTKSSK
IFDNYYYQDLVRRRGLLHSDQALFDDVATDDLVLKYSKNESAFFKDFGKSMIKMGNIKPVDGTPLEVRRNCRVVNT*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGAGTTCGTTCGAATCAGCCATTTTGATTGCTCTTCTTCTTCCATTAACTACTTCTGCATTGTCTTCAAATTATTACTCCAAATCCTGCCCCAACCTGTTCAAAGTCGTATAT
CCGGTGATAGCTAAAGCCATAAAACAGCAGCCTCGCAATGGTGCATCCATTCTGCGTCTCTTCTTCCACGACTGCTTCGTCAAT
ATGTTCGTCGTCGCAGCATTATTTTTTGTAATTTGA
TAAATTGATCTTCAATAATATTGTTGATTGTTATATATATATATATTATGGATCGGAGTACAGGGATGCGATGGATCAATTCTCTTAGACGACACACCGACTTTCACCGGAGAGAAAACG
GCATTTCCGAACTTAAACTCTGTCAGAGGATTTAATGTCATCGACGATGTAAAAGCCGCGGTGGAAGATGCATGTTCCGGAGTTGTCTCGTGTGCGGATATTTTGGCCATCGCCAGTCTA
GATGCTGTGTACATA
TAGTAAGTTTAATCATTATCCAATTAAATAGTTAAGTTAATGATCTACTTTTACTCTTGAAATATGTTTATTTTCTAACCAATCGATCAAATTTCAACGGTGAGA
TAAAAGTTTCTCTAACCCTAACTTTAAAAGTATCTCATGAGAATATATTTCATGTTTTGATTCGGAAAAAATACAGTTGGGGGGTCCGTGGTGGAAGTTGAAGCTCGGAAGACTAGATGC
AAGAACGGCGAGTAGAGATTTGGCAAACAAAAATCTCCCCGCTCCTTCTTTGAACCTTAAAGGCCTCAAAACAGCATTTAAAAACGTGGGTCTTTCCGAAAAAGATGTAGTCGTTCTCTC
CGGTGGGCACACCATAGGTTTAGCAAGATGTGTCACATTCAGAAACCACATATACAATGACACCGATATCGACCCCAAATTCGCCGCCAACCGTCAGAAAACATGTCCAAGATCTGGTGG
CAACAACAACCTTGCTCCGCTTGACACCAAATCATCAAAAATTTTCGACAACTACTACTACCAAGATCTTGTGAGGAGGAGAGGGCTTCTTCATTCGGATCAGGCTTTATTCGACGACGT
AGCCACCGACGATCTCGTGTTGAAGTATAGCAAAAATGAGTCCGCATTCTTCAAAGACTTCGGGAAATCTATGATAAAAATGGGTAACATTAAACCCGTCGACGGGACTCCTTTGGAAGT
AAGAAGGAACTGTAGGGTGGTGAACACTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGAGTTCGTTCGAATCAGCCATTTTGATTGCTCTTCTTCTTCCATTAACTACTTCTGCATTGTCTTCAAATTATTACTCCAAATCCTGCCCCAACCTGTTCAAAGTCGTATAT
CCGGTGATAGCTAAAGCCATAAAACAGCAGCCTCGCAATGGTGCATCCATTCTGCGTCTCTTCTTCCACGACTGCTTCGTCAAT
GGATGCGATGGATCAATTCTCTTAGACGACACACCG
ACTTTCACCGGAGAGAAAACGGCATTTCCGAACTTAAACTCTGTCAGAGGATTTAATGTCATCGACGATGTAAAAGCCGCGGTGGAAGATGCATGTTCCGGAGTTGTCTCGTGTGCGGAT
ATTTTGGCCATCGCCAGTCTAGATGCTGTGTACATA
TTGGGGGGTCCGTGGTGGAAGTTGAAGCTCGGAAGACTAGATGCAAGAACGGCGAGTAGAGATTTGGCAAACAAAAATCTCCCC
GCTCCTTCTTTGAACCTTAAAGGCCTCAAAACAGCATTTAAAAACGTGGGTCTTTCCGAAAAAGATGTAGTCGTTCTCTCCGGTGGGCACACCATAGGTTTAGCAAGATGTGTCACATTC
AGAAACCACATATACAATGACACCGATATCGACCCCAAATTCGCCGCCAACCGTCAGAAAACATGTCCAAGATCTGGTGGCAACAACAACCTTGCTCCGCTTGACACCAAATCATCAAAA
ATTTTCGACAACTACTACTACCAAGATCTTGTGAGGAGGAGAGGGCTTCTTCATTCGGATCAGGCTTTATTCGACGACGTAGCCACCGACGATCTCGTGTTGAAGTATAGCAAAAATGAG
TCCGCATTCTTCAAAGACTTCGGGAAATCTATGATAAAAATGGGTAACATTAAACCCGTCGACGGGACTCCTTTGGAAGTAAGAAGGAACTGTAGGGTGGTGAACACTTAA

Retrieve as FASTA