1. Browse the Database
  2. View Redoxidase
Entry information : EguPrx[P]188
Entry ID 11587
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-05-19 (Christophe Dunand)
Peroxidase information: EguPrx[P]188
Name EguPrx[P]188
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]188
start..stop		 S start..stop
EgrPrx[P]188 335 8.59e-120 1..186 1..184
EcamPrx[P]188 236 2.45e-80 8..186 1..204
EglPrx167 201 2.22e-66 33..186 69..222
EgrPrx167 200 1.19e-64 33..186 167..320
Gene structure Fichier Exons►


exon

Literature and cross-references EguPrx[P]188
Protein sequence: EguPrx[P]188
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   183
PWM (Da):   %s   18965.31 Transmb domain:   %s   o10-32i
PI (pH):   %s   4.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LEAKDILEIGEAMLVINYI*VKTIGIGLLYTEPKLNLSDLIxAFTNKGFTAQEMVALSGSHTIGxARCTTFRDQLYNESNMNxSFAAPSKANCPNSGGDNISPRNVTSPTSFDNG*FWxx
KSQKGLLHLDQQLLEGGSTDDHVTVYSDNLGLF*NDFAAAMDKDxGFLSPLTGSSSxIRMNCREVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing, Stops in frame). Scaffold_11_36687 (7297..11665)
DNA ►
Send to BLAST
CDS►
Send to BLAST