1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx23 (At2g38390 / PER23 / AtperoxP23 / ATP34)
Entry ID 116
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx23 (At2g38390 / PER23 / AtperoxP23 / ATP34)
Name (synonym) AtPrx23 (At2g38390 / PER23 / AtperoxP23 / ATP34)
Class Class III peroxidase    [Orthogroup: Prx047]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx23
start..stop		 S start..stop
AlyPrx23 662 0 1..349 1..349
AruPrx23 644 0 1..349 1..349
AhalPrx38 642 0 1..349 1..349
CrubPrx39 637 0 1..349 1..350
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx23 (At2g38390 / PER23 / AtperoxP23 / ATP34)
Literature Efetova M, Zeier J, Riederer M, Lee CW, Stingl N, Mueller M, Hartung W, Hedrich R, Deeken R.. A central role of abscisic acid in drought stress protection of Agrobacterium-induced tumors on Arabidopsis. Plant Physiol. 2007 Nov;145(3):853-62.
Protein ref. UniProtKB:   O80912
DNA ref. Phytozome 12:   Chr2 (16079726..16081381)
mRNA ref. GenBank:   NM_129395
Cluster/Prediction ref. Phytozome Gene 12:   19638178 UniGene:   At.28466
Omic ref. AtProteome:   At2g38390 ATTED-II:   At2g38390 e-FP Browser:   At2g38390 ePlant:   At2g38390 Genevestigator:   At2g38390 TAIR:   At2g38390
Protein sequence: AtPrx23 (At2g38390 / PER23 / AtperoxP23 / ATP34)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (320)
PWM (Da):   %s   37963.24 (35149.9)  
PI (pH):   %s   8.08 (8.20) Peptide Signal:   %s   cut: 30 range:30-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFSSSLSCSAMGALIVGCLLLQASNSNAQLRPDFYFRTCPPIFN
IIGDTIVNELRTDPRIAASLLRLHFHDCFVRGCDASILLDNSTSFRTEKDAAPNKNSVRGFDVIDRMKAAIERACPRTVSCADIITIASQISVLLSGGPWWPVPLGRRDSVEAFFALANTALPSPFSTLTQLKTAFADVGLNRPSDLVALSGGHTFGKAQCQFVTPRLYNFNGTNRPDPSLNPTYLVELRRLCPQNGNGTVLVNFDSVTPTTFDRQYYTNLLNGKGLIQSDQVLFSTPGADTIPLVNQYSSNTFVFFGAFVDAMIRMGNLK
PLTGTQGEIRQNCRVVNPRIRVVENDDGVVSSI

Retrieve as FASTA  
Remarks complete sequence from genomic (chromo 2, 3 introns), 4 cDNA and 17 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST