Entry information : CfioCP02_MH18
Entry ID 11813
Creation 2013-04-29 (Christophe Dunand)
Last sequence changes 2013-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-20 (Christophe Dunand)
Peroxidase information: CfioCP02_MH18
Name CfioCP02_MH18
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum fioriniae (Glomerella acutata)    [TaxId: 710243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CfioCP02_MH18
start..stop
S start..stop
CfioCP02_PJ7 1592 0 1..777 1..777
CgloCP01_ST23 1400 0 1..775 1..775
CgraCP02 1348 0 1..776 1..776
CgloCP01_Naragc5 1298 0 1..775 1..761
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11813' 'complement(join(205027..206266,206535..206670,206835..207266,207454..207526,207975..208129,208202..208499))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 208202..208499 296 N° 2 207975..208129 153 N° 3 207454..207526 71 N° 4 206835..207266 430
N° 5 206535..206670 134 N° 6 205027..206266 1238  
complement(join(205027..206266,206535..206670,206835..207266,207454..207526,2079 75..208129,208202..208499))


exon

Literature and cross-references CfioCP02_MH18
DNA ref. JGI genome:   scaffold_5 (208499..205027)
Cluster/Prediction ref. JGI gene:   1435547
Protein sequence: CfioCP02_MH18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   777 (756)
PWM (Da):   %s   84544.37 (82332.2)  
PI (pH):   %s   5.56 (5.28) Peptide Signal:   %s   cut: 22 range:22-777
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHAKLSSCLLAASALLPAVTAEGCPFAKRDGSVTSELPKRDTAEGFGRCSRISNQAGGGTRSHDWWPCQLRLDTLRQFQPATNPYGGDFDYTAAFNSLDYEALKKDLHALMTESQEWWPA
DFGHYGGLFIRMAWHSAGTYRAIDGRGGGGMGQQRFAPLNSWPDNQNLDKARRLLWPIKQKYGNKISWADLYLLTGNVALESMGFTPLGFAAGRPDTWQSDESVYWGGETTFVPKGNDVR
YNGSTDINERADKLEKPLGATHMGLIYVNPEGPDASSDPAASAKDIRVAFDRMGMNDEETVALIAGGHAFGKTHGAVPASNIGGEPEAADLGEMGLGWHNSVGDGNGVNQMTSGLEVVWT
KTPTKWSNGYLESLIHNKWTLVTSPAGAHQWEAVNGTLDYPDPFDATKFRKATMLTSDLALINDPSYLNITTRWLDHPQELADAFAKAWFKLLHRDLGPVARYLGPEIPKETFGWQDPLP
AREGELIDDADVTKLKSDILGTAGLDVSKLASVAWASASTFRHSDKRGGANGARIALEPQNKWVSNNPTVLTEVIDALKKIQTSFNTGAKKVSLADLIVLGGVAAVEKAASDAGVAVTVP
FTAGRVDATQEQTDVRAFSYLEPQADGFRNYGKGTARARTEEILVDKASQLTLSAPELTVLVGGLRALGATFDQSNTGVLTAKKGQLTNDWFINLLDISTVWSKTDTEGETWTGVDRKTK
AEKWTATRADLVFGSHAELRAISEVYASSDANEKFVKDFVAAWDKVMNLDRFDLKKY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGCCAAACTTTCCAGCTGCCTTTTGGCAGCTTCTGCTCTCCTGCCCGCCGTCACGGCTGAGGGCTGCCCTTTCGCCAAACGCGATGGTTCCGTCACCAGCGAGCTCCCCAAGAGA
GACACGGCTGAGGGCTTCGGCCGATGCTCGAGAATCAGCAACCAGGCTGGTGGCGGCACCCGCAGCCACGACTGGTGGCCTTGCCAGCTTAGACTCGATACTCTTCGCCAGTTCCAGCCC
GCGACCAACCCGTACGGAGGCGATTTCGACTACACTGCGGCTTTCAACTCTTTGGATT
GTGAGTAGAATCGATGGGGAGGGGGAAGAAGAAACACTGCATGGGAGGATCCTCACTAACAC
CCCACGTCAGATATGAGGCTCTGAAGAAGGACCTCCACGCCCTGATGACGGAGTCCCAGGAATGGTGGCCCGCCGACTTTGGCCACTATGGCGGTCTCTTCATCCGCATGGCCTGGCATA
GCGCCGGCACTTATCGCGCCATTGACGGGCGAGGTGGCGGTGGAATG
GTGAGCCGTTTTTTTTCTTCACTGCATCTCTTGGCTTATGTTTTACTCTCTTCTCTTTGGCTGTGTTATCCCG
AAAGTCCTTCCCTCCCTCCCCCCCCGCTCTCCCGGTCTTCCTAGTGCTTTTCCACTTGGCACAAGGTAGCTGGAAGAAACACCGCGTTGTAACCCCCCTCTCCATTTTAGCATATTTCTT
ATTCCTTGCCTACCGTTGCACTTGATCATCTCTTCGCGGTCCCATTCGTCTCGCGTTGGAAGATCAATTGGCTAGACGGAGGTTTTTGTCCTATCCCGGATCAAAGCCAAGAGGTGCTAA
AGCATCTCGCTCGCCTTTTTCTCCACCCGCACCGCGTCACGAAATATGGACCTGGGCTGTTTGCATCTTATCACATCTCTGCATCAGTTTAATTCTTCTTGAGGACTGGCGTTTACTAAT
ATTGGACTCCTGCAGGGGGCCAACAACGTTTCGCTCCGCTTAACAGCTGGCCTGACAACCAGAACCTCGACAAGGCTCGCCGCCTGCTGTGTAAGATTTCCAATCCTTATGCGCTCTTTT
GCGATTCGGCCCACCCATGTTCGACTTGCATCATCGACTCGGTAGCGATATCCACTTTGCCGTGGCTCGATGGTGCGAGTAGAGCGATGTTGTGGGCCCCTTGAGAGATAGAGAGAGAAG
AAACGTTTGCTAATCCTAACTCTTTCACTTTTTACAGGGGGCCTATCAAGCAAAAGTACGGCAACAAGATCTCATGGGCCGACTTGTACCTCCTCACCGGCAACGTTGCCCTTGAGTCCA
TGGGCTTCACCCCTCTTGGCTTCGCCGCTGGCCGTCCCGATACTTGGCAATCCGATGAGTCCGTCTACTGGGGTGGAGAGACGACCTTCGTCCCCAAGGGTAACGATGTCCGCTACAATG
GCAGCACCGACATCAACGAGCGCGCCGACAAGCTCGAGAAGCCCCTGGGTGCCACCCACATGGGTCTCATCTACGTCAACCCGGAGGGCCCCGATGCCAGCTCCGACCCCGCCGCTTCGG
CCAAGGACATCCGCGTCGCTTTCGATCGCATGGGAATGAACGATGAGGAGACCGTCGCTCTGATCGCCGGTGGACACGCCTTTGGCAAGACGCACGGTGCCGTGCCTGCAA
GTGAGTTGC
ACATCATTCACGCCCCCCATCTTCACGATCCCGGTTCAAGTCGGACGAACGGGCGAGAATTGAGCGCCTCCGGAGAGAGCTCCGGGTTACCCCCGGGAACACGATTTTCACCGCCATTTT
TGGAACATGCAGATGCTAATCCGCGTCTCTCATAGGCGCAACATTGGAGGTGAGCCCGAGGCCGCTGACCTTGGCGAGATGGGTCTCGGATGGCACAACAGCGTCGGTGATGGCAACGGT
GTCAACCAGATGACCAGTGGTCTTGAGGTTGTCTGGACCAAGACCCCTACCAA
GTAAGTGATGATTGTGATGAGTCTATTTCCGTTTGCATTTGCGGCCCCCCCATTCTTGGCACTCCAG
CCGTTCTCATTTCCCCTCTTCTCACTCTTGAGGCCTCTTTTATCTCTCATTAGCCGAATCTTCGCCCTCGAAAGAGAGAGAGAGAAGGCCATGAGAGAAATGATGAGGCGACAAACGACG
AGGCCAAGAAAAGCTATTTATACATCAACCACACCGGGTGATTATGCAGTGACACACCGACGCTAATCCTTGTACCTGCAGATATGGAGCAACGGCTACTTGGAGTCTCTCATTCACAAC
AAATGGACCCTCGTCACCAGCCCTGCCGGCGCTCACCAATGGGAGGCTGTCAACGGCACTCTCGACTACCCCGACCCCTTTGACGCTACCAAGTTCCGCAAGGCCACCATGCTCACCAGC
GACTTGGCTCTCATCAATGACCCGTCCTACCTCAACATCACCACCCGCTGGCTCGATCACCCCCAGGAGCTCGCCGATGCCTTCGCCAAGGCTTGGTTCAAGCTTCTTCACCGTGACTTG
GGTCCCGTCGCCCGCTACCTCGGTCCCGAGATCCCCAAGGAGACTTTCGGCTGGCAGGATCCCCTTCCCGCTAGGGAGGGTGAGCTCATTGACGATGCCGATGTGACCAAGCTCAAGTCT
GACATTCTTGGCACCGCCGGTCTCGACGTTTCCAAGCTCGCCTCCGTCGCCTGGGCCTCCGCCTCTACCTTCCGTCACTCCGACAAGCGTGGTGGTGCCAACGGTGCCCGCATCGCCCTC
GAGCCCCAGAACAAGTGGGTTTCCAACAACCCTACCGTCCTCACCGAGGTTATCGACGCCCTTAAGAAGATCCAGACCAGCTTCAACACCGGTGCCAAGAAGGTCTCCCTCGCCGACTTG
ATCGTTCTCGGGGGTGTCGCCGCCGTCGAGAAGGCCGCTTCTGACGCTGGTGTCGCCGTCACCGTCCCCTTCACCGCCGGCCGTGTCGACGCCACCCAGGAGCAGACCGACGTCCGCGCT
TTCAGCTACCTCGAGCCCCAGGCCGACGGCTTCCGCAACTACGGCAAGGGTACCGCCCGCGCTCGCACTGAGGAGATCCTCGTCGACAAGGCCTCCCAGCTCACCCTCTCCGCCCCCGAG
CTGACCGTCCTCGTCGGTGGTCTCCGCGCCCTCGGCGCCACCTTCGACCAGTCCAACACCGGTGTTCTTACCGCCAAGAAGGGCCAGCTGACCAACGACTGGTTCATCAACCTGCTCGAT
ATCTCCACCGTCTGGTCCAAGACCGATACCGAGGGCGAGACCTGGACCGGTGTTGACCGCAAGACCAAGGCCGAGAAGTGGACCGCCACCCGTGCCGATCTCGTGTTCGGATCCCACGCC
GAGCTCCGTGCCATCTCTGAGGTCTACGCCAGCTCCGACGCCAACGAGAAGTTCGTCAAGGACTTCGTCGCTGCGTGGGACAAGGTCATGAACCTTGACCGCTTCGACTTGAAGAAGTAC
TAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGCCAAACTTTCCAGCTGCCTTTTGGCAGCTTCTGCTCTCCTGCCCGCCGTCACGGCTGAGGGCTGCCCTTTCGCCAAACGCGATGGTTCCGTCACCAGCGAGCTCCCCAAGAGA
GACACGGCTGAGGGCTTCGGCCGATGCTCGAGAATCAGCAACCAGGCTGGTGGCGGCACCCGCAGCCACGACTGGTGGCCTTGCCAGCTTAGACTCGATACTCTTCGCCAGTTCCAGCCC
GCGACCAACCCGTACGGAGGCGATTTCGACTACACTGCGGCTTTCAACTCTTTGGATT
ATGAGGCTCTGAAGAAGGACCTCCACGCCCTGATGACGGAGTCCCAGGAATGGTGGCCCGCC
GACTTTGGCCACTATGGCGGTCTCTTCATCCGCATGGCCTGGCATAGCGCCGGCACTTATCGCGCCATTGACGGGCGAGGTGGCGGTGGAATG
GGCCAACAACGTTTCGCTCCGCTTAAC
AGCTGGCCTGACAACCAGAACCTCGACAAGGCTCGCCGCCTGCTGT
GGCCTATCAAGCAAAAGTACGGCAACAAGATCTCATGGGCCGACTTGTACCTCCTCACCGGCAACGTTGCCCTT
GAGTCCATGGGCTTCACCCCTCTTGGCTTCGCCGCTGGCCGTCCCGATACTTGGCAATCCGATGAGTCCGTCTACTGGGGTGGAGAGACGACCTTCGTCCCCAAGGGTAACGATGTCCGC
TACAATGGCAGCACCGACATCAACGAGCGCGCCGACAAGCTCGAGAAGCCCCTGGGTGCCACCCACATGGGTCTCATCTACGTCAACCCGGAGGGCCCCGATGCCAGCTCCGACCCCGCC
GCTTCGGCCAAGGACATCCGCGTCGCTTTCGATCGCATGGGAATGAACGATGAGGAGACCGTCGCTCTGATCGCCGGTGGACACGCCTTTGGCAAGACGCACGGTGCCGTGCCTGCAA
GC
AACATTGGAGGTGAGCCCGAGGCCGCTGACCTTGGCGAGATGGGTCTCGGATGGCACAACAGCGTCGGTGATGGCAACGGTGTCAACCAGATGACCAGTGGTCTTGAGGTTGTCTGGACC
AAGACCCCTACCAA
ATGGAGCAACGGCTACTTGGAGTCTCTCATTCACAACAAATGGACCCTCGTCACCAGCCCTGCCGGCGCTCACCAATGGGAGGCTGTCAACGGCACTCTCGACTAC
CCCGACCCCTTTGACGCTACCAAGTTCCGCAAGGCCACCATGCTCACCAGCGACTTGGCTCTCATCAATGACCCGTCCTACCTCAACATCACCACCCGCTGGCTCGATCACCCCCAGGAG
CTCGCCGATGCCTTCGCCAAGGCTTGGTTCAAGCTTCTTCACCGTGACTTGGGTCCCGTCGCCCGCTACCTCGGTCCCGAGATCCCCAAGGAGACTTTCGGCTGGCAGGATCCCCTTCCC
GCTAGGGAGGGTGAGCTCATTGACGATGCCGATGTGACCAAGCTCAAGTCTGACATTCTTGGCACCGCCGGTCTCGACGTTTCCAAGCTCGCCTCCGTCGCCTGGGCCTCCGCCTCTACC
TTCCGTCACTCCGACAAGCGTGGTGGTGCCAACGGTGCCCGCATCGCCCTCGAGCCCCAGAACAAGTGGGTTTCCAACAACCCTACCGTCCTCACCGAGGTTATCGACGCCCTTAAGAAG
ATCCAGACCAGCTTCAACACCGGTGCCAAGAAGGTCTCCCTCGCCGACTTGATCGTTCTCGGGGGTGTCGCCGCCGTCGAGAAGGCCGCTTCTGACGCTGGTGTCGCCGTCACCGTCCCC
TTCACCGCCGGCCGTGTCGACGCCACCCAGGAGCAGACCGACGTCCGCGCTTTCAGCTACCTCGAGCCCCAGGCCGACGGCTTCCGCAACTACGGCAAGGGTACCGCCCGCGCTCGCACT
GAGGAGATCCTCGTCGACAAGGCCTCCCAGCTCACCCTCTCCGCCCCCGAGCTGACCGTCCTCGTCGGTGGTCTCCGCGCCCTCGGCGCCACCTTCGACCAGTCCAACACCGGTGTTCTT
ACCGCCAAGAAGGGCCAGCTGACCAACGACTGGTTCATCAACCTGCTCGATATCTCCACCGTCTGGTCCAAGACCGATACCGAGGGCGAGACCTGGACCGGTGTTGACCGCAAGACCAAG
GCCGAGAAGTGGACCGCCACCCGTGCCGATCTCGTGTTCGGATCCCACGCCGAGCTCCGTGCCATCTCTGAGGTCTACGCCAGCTCCGACGCCAACGAGAAGTTCGTCAAGGACTTCGTC
GCTGCGTGGGACAAGGTCATGAACCTTGACCGCTTCGACTTGAAGAAGTACTAA

Retrieve as FASTA