Entry information : LuGPx212(Lus10042692|PACid:23181815)
Entry ID 12051
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx212(Lus10042692|PACid:23181815)
Name LuGPx212(Lus10042692|PACid:23181815)
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx212
start..stop
S start..stop
LuGPx165 216 7.75e-74 1..107 1..107
PtGPx05 191 2.91e-64 1..108 1..108
EguGPx09 191 5.8e-64 1..108 1..108
EgrGPx09 190 5.99e-64 1..108 1..108
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12051' 'join(1542631..1542684,1542780..1542856,1542999..1543060,1543216..1543334,1544472..1544507)' Exons


exon

Literature and cross-references LuGPx212(Lus10042692|PACid:23181815)
DNA ref. Phytozome 12:   scaffold67 (1542631..1544507)
Protein sequence: LuGPx212(Lus10042692|PACid:23181815)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   115
PWM (Da):   %s   13057.45  
PI (pH):   %s   5.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVSGSVPEKSIHEFAVKDSRGKDVELSIYQGKVLLVVNVASKCGFTDTNYTQLTDLYRKYKDQGFEILAFPCNQFLNQEPGTSEEAQEFACTRYKAEYPIFQKTHIQKELGDQE*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 3' end is missing.
DNA
Send to BLAST
CDS
Send to BLAST