Entry information : LuPrx13 (Lus10001324|PACid:23146550)
Entry ID 12082
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-18 (Christophe Dunand)
Peroxidase information: LuPrx13 (Lus10001324|PACid:23146550)
Name (synonym) LuPrx13 (Lus10001324|PACid:23146550)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation Cell wall
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx13
start..stop
S start..stop
LuPrx77 649 0 1..331 1..332
LuPrx29 457 1.94e-163 5..330 4..319
LuPrx110 442 6.53e-157 5..330 4..325
EgrPrx48 388 4.19e-136 30..330 23..319
Gene structure Fichier Exons


exon

Literature and cross-references LuPrx13 (Lus10001324|PACid:23146550)
Literature Day A1, Fénart S, Neutelings G, Hawkins S, Rolando C, Tokarski C. Identification of cell wall proteins in the flax (Linum usitatissimum) stem. Proteomics. 2013 13(5):812-25.
DNA ref. Phytozome 12:   scaffold2292 (4868..3458)
Protein sequence: LuPrx13 (Lus10001324|PACid:23146550)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (305)
PWM (Da):   %s   35261.64 (32506.2) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.93 (7.31) Peptide Signal:   %s   cut: 26 range:26-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAKKMSVLIVGYVFFLCNAVAVSAGADGMKVGFYKSTCPEAETIVRKVVQKWYNNDRSIPAALLHLQFHDCFVNGCDASILIDSTAQNPSEKAAGPSQTVRGYDLLDAVKAELEAACPS
RVSCADIVALATRDAVVLAGGPTYALPTGRLDGVVSKPSDVKLPGPTLNISQAFTQFFQPLGFTLAEMVTLLGAHTVGVAHCSSFRDRISDFKGTGRPDPSMDPNLVVSLRKTCSTTGSN
KNNNTNPTAFLDQNTSFAVDNSYYRELRSKKGVLSFDQALDSDGSTTGIVSTFARSEMEFRTSFAAAMVKMGNIVGGGDGEIRKNCRVFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Experimental evidency of cell wall localization
DNA
Send to BLAST
CDS
Send to BLAST