Entry information : LuRboh132(Lus10024683|PACid:23161549)
Entry ID 12200
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuRboh132(Lus10024683|PACid:23161549)
Name LuRboh132(Lus10024683|PACid:23161549)
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh011]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuRboh132
start..stop
S start..stop
CsRboh01 1392 0 3..893 7..947
CclRboh01 1389 0 3..893 7..947
CarRboh05 1312 0 2..892 6..946
LuRboh159 1307 0 1..893 1..932
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12200' 'join(757844..758543,758646..758805,759005..759053,759711..759824,760666..761088,761417..761605,761881..761976,762066..762181,762282..762449,762534..762693,762797..762982,763090..763297,763398..763507)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 757844..758543 698 N° 2 758646..758805 158 N° 3 759005..759053 47 N° 4 759711..759824 112
N° 5 760666..761088 421 N° 6 761417..761605 187 N° 7 761881..761976 94 N° 8 762066..762181 114
N° 9 762282..762449 166 N° 10 762534..762693 158 N° 11 762797..762982 184 N° 12 763090..763297 206
N° 13 763398..763507 108  
join(757844..758543,758646..758805,759005..759053,759711..759824,760666..761088, 761417..761605,761881..761976,762066..762181,762282..762449,762534..762693,76279 7..762982,763090..763297,763398..763507)


exon

Literature and cross-references LuRboh132(Lus10024683|PACid:23161549)
DNA ref. Phytozome 12:   scaffold349 (757844..763507)
Protein sequence: LuRboh132(Lus10024683|PACid:23161549)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   892
PWM (Da):   %s   100861.55 Transmb domain:   %s   i13-35o
PI (pH):   %s   9.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKHERRWRSDSLPGKGRAADSSSSSSAGTSPASDARSSTAAATEDFVEVTLDLQDDDTIILRSVEPATVINIGGEEGDHESGGSELLPRSTPTSAPTSRSPTIKRSSSNKLRQFSQELKA
DAVAKARQFSLDVRAELRRFSRSRGGTASRNNNPENNNNGGAVFESALAARALRKQRAQLDRTRTSAHKALRGLKFISKRKSQGVEAWNEVASNFDKLAVDGYLQRADFAQCIGMRDSKE
FALELFDGLSRRRRLKVEKLSKEELYEFWAQITDDSFDSRLQIFFDMVDKNEDGRLTEEDVKEIIMLSASANKLSRLKEQAEEYAALIMEELDPEGLGYIELWQLETLLLQKDTYQNYSQ
AMSYTSQALSQNLQGLRMRSPIRRMSTNFVYFLEMNWKRIWVISLWIMIMIGLFAWKFYQYKQKAAFNVMGYCLLTAKGAAETLKFNMALILLPVCRNTITRLRSTRLAYVFPFDDNINF
HKTIAAAIVVGVILHVGNHLACDFPRLESASAHDYDLYLRKDFGDHKPSYMKLVRGVEGVTGILMTWMYLSVPVLLYAGERALRFFRSGSHSVRLLKVAIYPGNVLTLQMSKPTQFRYKS
GQYMFVQCPAVSPFEWHPFSITSAPGDDYLSVHIRQLGDWTQELKRVFSEVCERPISGKSGLLRADETTKRSLPKLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPFISILKDLLNNIVK
MEEMADSVADSSRGSDQLSFTSTTDFMRRKKALIKTTNAYFYWVTREQGSFDWFKGVMNEIADLDQRGVLEMHNYLTSVYEEGDARSTLITMVQALNHAKNGVDIVSGTRVRTHFARPNW
KKVLSKLSSKHCNARIGVFYCGAPVLANELGKLCYEFNQKGSTKFEFHKEHF*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCACGAGAGGCGATGGCGATCGGATTCCTTACCTGGAAAGGGCAGAGCAGCTGACAGCAGTAGCAGCAGCAGCGCGGGGACTTCTCCGGCGAGCGATGCGAGAAGCTCGACAGCG
GCAGCGACGGAGGATTTCGTCGAGGTCACGCTCGATTTGCAGGACGACGATACGATTATACTCCGAAGCGTTGAGCCGGCGACGGTGATCAATATCGGCGGAGAGGAAGGCGATCACGAG
AGCGGCGGAAGCGAGCTGTTACCTCGTTCGACTCCTACTTCCGCTCCGACTTCCAGATCTCCTACGATCAAGCGAAGCTCGTCAAACAAGCTGCGGCAGTTCTCGCAGGAGCTGAAGGCG
GATGCAGTGGCGAAGGCGAGACAATTCTCGCTGGATGTGAGAGCTGAGCTACGTAGGTTCTCGAGGAGCCGCGGAGGAACAGCGTCGCGTAATAATAATCCGGAGAACAACAACAATGGC
GGTGCTGTATTTGAGTCCGCGTTGGCTGCTCGAGCTCTGAGGAAGCAGCGAGCTCAGCTCGATCGGACCAGGACCAGCGCTCACAAAGCCCTGCGGGGTCTCAAGTTCATCAGTAAGAGG
AAATCTCAAGGCGTCGAGGCGTGGAATGAAGTGGCCAGCAACTTCGATAAGCTCGCCGTGGACGGTTATCTCCAACGCGCAGATTTCGCGCAATGCATAG
AGGTTAGTTTTTAAATCCCT
AATCACGTCGACATTTCAGTTTTTTTCAATTCGATTTGGATAATTTCGTCTGGTGAATTGATTTTGTAAAGTTCTCCCCTGTAGGGATGAGAGACTCTAAAGAGTTTGCACTCGAACTGT
TCGACGGATTGAGCAGGAGAAGGAGGTTGAAGGTTGAGAAGCTTAGCAAGGAGGAGTTGTACGAATTCTGGGCACAAATCACCGATGACAGCTTCGACTCACGGCTTCAGATCTTCTTCG
ACAT
ATGTATGCAGAAAAGCACAAACCAATGATGATTGATCAATTTAGACTAGTTGATCGCCTCCTTAATTAATTAATTAGTCAATACTGATTTGGTATTAGCCGTTTGACAAGACAAAA
TCGTCCTTTCTGACGTGTCCATTTCTTATTGCTCTACGTTTCGGATGCTTGTGAGTTTTCCTAACAGTAATGCTTATTGTAACAGGGTGGACAAGAATGAAGATGGTAGACTCACAGAGG
AAGACGTAAAAGAG
AGGTACCTGCAGTTTCTTGTTTATCTTATCAATTCTTGTATAATAATCATTGAAAGAATCAGTCTACATTACTGTTGTGATTTTCATGGTTAACTTAAAGGTCTAA
GCCTAGAGTCGTGAATTAGTCAATTAGGCACCACTACCCTGTCAATTGCTTGAGGAAGAAACTAACTCATCAATATTTTAACCAGCCATTTTAGCAGCCGTCTATCCCCACAGAAGTGTC
GTAGGACTTTTTTATAAAGTAAGCAATTTGGCTTTATTATTGATATCTTACTGAAGAGGGTAGGCTTGAAATTTGCATCAAATTTAAATTCCCAGGACTAACTGCTCCATTACTGCAATG
AAACCATATTGTGTTGTTTCCACGATTCGTTTGTTTATCAAACGATTCCATTATATATAGTGACGTTCCCTATATTCTGACTTCTGAAATATTATCTTTGAATTGTTGGACTGGATCTAC
TCCTCTTAGTAAAAGGGGTTTGGAATTGGGTTGACAACGTTTGGCATTTTTTTATGTTCCAACTTCCGAACGTAGCGTCAGGAAGTTTACATGTCATTTTGTTGTTTGGGTTAGGTAGGA
GGCTTTATTCGTTCTTGTGTTTTTACCTTTTTTCTTACTAATTACTGACTTTCTATTCTCTGTACTTTTATAGATTATTATGTTAAGTGCTTCGGCGAATAAACTATCAAGATTGAAGGA
ACAAGCGGAAGAATATGCAGCTTTGATCATGGAAGAGTTGGACCCTGAAGGACTTGGCTACATCGAG
AGGTGGGTCCTAGTCCTACATTTATGTGTTCACTTACGTTGATTCTTGTGCTA
GAAGCAATAGCGTTAAACTGCATTGACATATAATTATAAGTCTTAAACAAGAATATTATTCAAGTAAGGAGTCATTTTCAGTCTAGTTTTCACATACTAGTTAACTGCTCTTTGCGGGGA
GGTTGTTAGGCTAAATACATGTTTAATGAAAGCCAAGTCTGACCATTCTTTAGATTCTTAATCAATTACCAAACAAGAATCGGTTACAACATTTCTATCATGATGCTTCTTCTTTCAAAG
TCCATGAATTGTTAGGCAAAAAACAATGAGATAGATAAGTCATCGAGAATTGGGGTTGTGATGTTGTTCAACTGTGAACGAAGAAAAAAAAGATGATGAAACAAGTGGAGAAGGATCATT
AATTTGGTTAAGTAAACTTATCTAAGTGGATTTCTCGTTGTCGGTGGTTCAACAGCTTTCCTAGTTGTTGCTTATTTTTCCATCTTTCCGCCTTCCCATAACCTGCTCTACTATTTTTAG
TTGATTGTCATGTTATTGTGGCATGATTAGCTAGTGAACAGTATATAAAATATTAGCATACGCTAGTGACATAACATGGTCTGTCAAATTGTCAATTGGGTATGGAGGGAAATCTAGCTA
GAGAGTAAATGCCATTGATTGTTGAGAAATTCTTGCGACTCATAAAACATAATTGAACAAAAATACTGATCACATCATAGCTTCAGTACTTTTGGAGAGAAAATCGTTTCATCTCCAGTA
CTTTTACTGGCCTAGTTGCAGTGACCGAGAGATACCATACCATAGTCCTAAGTTGATAATGATACTGCAGCTATGGCAACTGGAGACGCTTCTTCTACAAAAGGACACATATCAAAACTA
CAGTCAAGCAATGAGCTACACAAGCCAAGCCTTGAGCCAGAACTTGCAAGGGCTAAGAATGAGAAGCCCAATAAGGAGGATGAGCACAAACTTTGTCTACTTCTTGGAAATGAACTGGAA
GAGGATCTGGGTGATATCCTTATGGATCATGATCATGATTGGACTGTTCGCATGGAAATTCTATCAGTATAAGCAGAAAGCTGCCTTCAATGTCATGGGTTACTGTCTCCTGACGGCAAA
GGGTGCTGCGGAAACTCTGAAGTTCAACATGGCCCTCATTCTGCTTCCCGTGTGTAGAAACACCATCACTCGGCTCAGGTCCACACGTCTGGCTTATGTTTTCCCTTTCGATGACAACAT
AAACTTCCACAAG
AGGTACATTTTCCTAATTTCACCAACCCCCTTTTCTTCCGTTAGTCTTGCTGAAACTGCTTTACTTGTTTAGTACGTTAATCAAGTGGGGTCATATCATGGAGACTT
TATTAGACAGTACTATGATGGTTGATCTTATATCCGTGTAGTTCGATGATGTTACTGTTCCAAAAGTTAGTGATCACTTTATTCCAAGGAAGAAAGACAAAAAGGAAAAGCTTGCTCAGT
TAATTTTACGACTTCTTAGGCTAAACAGATAGAACAATCAGTATATTGCATCGAAACAGGCATTGACAAAACTGTACTTGGCGTTCTTCCTTTATGTCTGCAGACTATTGCGGCAGCAAT
CGTAGTTGGCGTCATCCTTCACGTTGGAAACCACCTTGCCTGTGATTTCCCGAGGCTCGAAAGCGCTTCTGCCCATGACTACGATCTGTATCTCAGAAAAGACTTCGGAGACCATAAACC
CAGTTACATGAAATTAGTTAGGGGGGTAGAGGGCGTGACTGGAATCCTGATG
TGGTAATTTTCATGGCAATTGCATTCACCCTGGCAACGAGATGGTTCAGGCGTAACCTCATTAAGTTT
CCCAAACCGTTTGACAGAATCACTGGGTTCAATGCCTTCTGGTATTCACACCACTTATTTGTCCTCGTCTATATATTGCTGGTCGTCCATGGTATATTCCTCTACCTGGTTCATCACTGG
TATAAGAAAACGGTAAGGTTCCCAATATTGCTTCCTTCCCTTTCAATAGATTCATCGTTCCATTTAGGACGTTTTTACATTCCCGGCAGACATGGATGTACCTCTCTGTTCCTGTGCTGC
TTTACGCCGGAGAAAGAGCCCTCAGGTTCTTCCGCTCTGGCTCCCATTCAGTCCGGCTTTTGAAG
AGGTTAGTTAGCAGCCTATTAATAGTGTTATATGATTGCCCAAAGGATCTGTCTA
TAAGCTATTTACCATTGTTGATATATGCGTTTCCAGGTTGCAATTTACCCTGGCAACGTACTCACATTGCAAATGTCAAAGCCTACTCAATTCCGGTACAAGAGCGGGCAGTACATGTTC
GTTCAGTGCCCTGCTGTTTCTCCATTTGAATG
TGGTAAAATACTCTGCTTTTTCTTCTGTTGCCTTTTTTCTCTTCTCTTGTTCTGTCATAATCTTAAGACTTATATCTGATTCAATTAT
CAATTTCTCCCCAGGCACCCATTCTCGATAACTTCAGCTCCTGGAGATGACTACCTTAGCGTCCATATCCGACAGCTAGGCGATTGGACACAAGAACTGAAAAGGGTATTCTCTGAGGTC
TGCGAGCGTCCTATTTCTGGCAAAAGTGGCCTTCTTAGAGCTGATGAAACCACCAAGAGAAG
AGGTGATTAGCTGAATCTGGTCAACATTTCCTTTCTTTATTTTTCTCTGCACAATGGT
GAATCATTTGCTATGTCCGATTATACAGTTTGCCGAAGCTGTTAATAGATGGGCCGTACGGTGCCCCAGCGCAAGACTACAAGAAATACGACGTCTTGTTACTCGTAGGGTTGGGTATCG
GAGCAACGCCTTTCATCAGCATTCTCAAAGACTTGCTTAACAACATCGTCAAGATGGAGGAGATGGCT
CTGTAAGTAAACTACACTAGAAAAGGAAATAAGAAAAAAATGGACTGAATCT
GTTTCCATTCCAACTAACATTCATAGCCACATTAATTCTTCATGTTTGTGCAGGATTCCGTAGCGGACTCCAGCAGAGGTTCAGATCAGCTGAGCTTCACGAGCACCACCGACTTTATGA
GACGGAAGAAGGCATTGATAAAAACCACAAACGCTTACTTCTACTGGGTAACAAGGGAACAAGGCTCATTCGATTGGTTCAAAGGCGTGATGAACGAGATTGCCGACCTTGATCAGAGG
G
GGTACGTAAGAATTAGTACATAACACACACAAATGCTGCTATACCTTAGTCATTGGATTTGGCTACTTACCTGAGAAAAGAATGGAATTGGTGTGTTAATCAATCCAGGGGGTACTTGAG
ATGCACAACTACTTAACCAGCGTATACGAGGAAGGGGACGCGAGATCGACTCTGATAACGATGGTGCAAGCATTGAACCATGCCAAAAACGGAGTGGACATTGTCTCGGGGACTAGGGTG
CGAACTCATTTCGCGAGGCCTAACTGGAAGAAGGTGCTCTCAAAACTAAGCTCAAAGCACTGTAATGCAAGGATAG
AGGTAAACGCATCAATCTCTTTTTTCCTCTATATACTTCCCCAG
TTAGTCATGTTTGATCTGAAAAGGGTTTTGATTATTGATGTTCTGGTGGGGAATGCAGGGGTATTCTACTGTGGGGCACCAGTTCTGGCCAACGAACTCGGAAAGCTATGCTACGAGTTC
AACCAGAAGGGTTCTACCAAGTTCGAATTCCACAAGGAGCATTTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCACGAGAGGCGATGGCGATCGGATTCCTTACCTGGAAAGGGCAGAGCAGCTGACAGCAGTAGCAGCAGCAGCGCGGGGACTTCTCCGGCGAGCGATGCGAGAAGCTCGACAGCG
GCAGCGACGGAGGATTTCGTCGAGGTCACGCTCGATTTGCAGGACGACGATACGATTATACTCCGAAGCGTTGAGCCGGCGACGGTGATCAATATCGGCGGAGAGGAAGGCGATCACGAG
AGCGGCGGAAGCGAGCTGTTACCTCGTTCGACTCCTACTTCCGCTCCGACTTCCAGATCTCCTACGATCAAGCGAAGCTCGTCAAACAAGCTGCGGCAGTTCTCGCAGGAGCTGAAGGCG
GATGCAGTGGCGAAGGCGAGACAATTCTCGCTGGATGTGAGAGCTGAGCTACGTAGGTTCTCGAGGAGCCGCGGAGGAACAGCGTCGCGTAATAATAATCCGGAGAACAACAACAATGGC
GGTGCTGTATTTGAGTCCGCGTTGGCTGCTCGAGCTCTGAGGAAGCAGCGAGCTCAGCTCGATCGGACCAGGACCAGCGCTCACAAAGCCCTGCGGGGTCTCAAGTTCATCAGTAAGAGG
AAATCTCAAGGCGTCGAGGCGTGGAATGAAGTGGCCAGCAACTTCGATAAGCTCGCCGTGGACGGTTATCTCCAACGCGCAGATTTCGCGCAATGCATAG
GGATGAGAGACTCTAAAGAG
TTTGCACTCGAACTGTTCGACGGATTGAGCAGGAGAAGGAGGTTGAAGGTTGAGAAGCTTAGCAAGGAGGAGTTGTACGAATTCTGGGCACAAATCACCGATGACAGCTTCGACTCACGG
CTTCAGATCTTCTTCGACAT
GGTGGACAAGAATGAAGATGGTAGACTCACAGAGGAAGACGTAAAAGAGATTATTATGTTAAGTGCTTCGGCGAATAAACTATCAAGATTGAAGGAACAA
GCGGAAGAATATGCAGCTTTGATCATGGAAGAGTTGGACCCTGAAGGACTTGGCTACATCGAG
CTATGGCAACTGGAGACGCTTCTTCTACAAAAGGACACATATCAAAACTACAGTCAA
GCAATGAGCTACACAAGCCAAGCCTTGAGCCAGAACTTGCAAGGGCTAAGAATGAGAAGCCCAATAAGGAGGATGAGCACAAACTTTGTCTACTTCTTGGAAATGAACTGGAAGAGGATC
TGGGTGATATCCTTATGGATCATGATCATGATTGGACTGTTCGCATGGAAATTCTATCAGTATAAGCAGAAAGCTGCCTTCAATGTCATGGGTTACTGTCTCCTGACGGCAAAGGGTGCT
GCGGAAACTCTGAAGTTCAACATGGCCCTCATTCTGCTTCCCGTGTGTAGAAACACCATCACTCGGCTCAGGTCCACACGTCTGGCTTATGTTTTCCCTTTCGATGACAACATAAACTTC
CACAAG
ACTATTGCGGCAGCAATCGTAGTTGGCGTCATCCTTCACGTTGGAAACCACCTTGCCTGTGATTTCCCGAGGCTCGAAAGCGCTTCTGCCCATGACTACGATCTGTATCTCAGA
AAAGACTTCGGAGACCATAAACCCAGTTACATGAAATTAGTTAGGGGGGTAGAGGGCGTGACTGGAATCCTGATG
ACATGGATGTACCTCTCTGTTCCTGTGCTGCTTTACGCCGGAGAA
AGAGCCCTCAGGTTCTTCCGCTCTGGCTCCCATTCAGTCCGGCTTTTGAAG
GTTGCAATTTACCCTGGCAACGTACTCACATTGCAAATGTCAAAGCCTACTCAATTCCGGTACAAGAGC
GGGCAGTACATGTTCGTTCAGTGCCCTGCTGTTTCTCCATTTGAATG
GCACCCATTCTCGATAACTTCAGCTCCTGGAGATGACTACCTTAGCGTCCATATCCGACAGCTAGGCGATTGG
ACACAAGAACTGAAAAGGGTATTCTCTGAGGTCTGCGAGCGTCCTATTTCTGGCAAAAGTGGCCTTCTTAGAGCTGATGAAACCACCAAGAGAAG
TTTGCCGAAGCTGTTAATAGATGGG
CCGTACGGTGCCCCAGCGCAAGACTACAAGAAATACGACGTCTTGTTACTCGTAGGGTTGGGTATCGGAGCAACGCCTTTCATCAGCATTCTCAAAGACTTGCTTAACAACATCGTCAAG
ATGGAGGAGATGGCT
GATTCCGTAGCGGACTCCAGCAGAGGTTCAGATCAGCTGAGCTTCACGAGCACCACCGACTTTATGAGACGGAAGAAGGCATTGATAAAAACCACAAACGCTTAC
TTCTACTGGGTAACAAGGGAACAAGGCTCATTCGATTGGTTCAAAGGCGTGATGAACGAGATTGCCGACCTTGATCAGAGG
GGGGTACTTGAGATGCACAACTACTTAACCAGCGTATAC
GAGGAAGGGGACGCGAGATCGACTCTGATAACGATGGTGCAAGCATTGAACCATGCCAAAAACGGAGTGGACATTGTCTCGGGGACTAGGGTGCGAACTCATTTCGCGAGGCCTAACTGG
AAGAAGGTGCTCTCAAAACTAAGCTCAAAGCACTGTAATGCAAGGATAG
GGGTATTCTACTGTGGGGCACCAGTTCTGGCCAACGAACTCGGAAAGCTATGCTACGAGTTCAACCAGAAG
GGTTCTACCAAGTTCGAATTCCACAAGGAGCATTTCTAG

Retrieve as FASTA