Entry information : LfluGPx01
Entry ID 12246
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: LfluGPx01
Name LfluGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Lentitheciaceae Lentithecium
Organism Lentithecium fluviatile    [TaxId: 690899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LfluGPx01
start..stop
S start..stop
CcassGPx01 324 8.97e-114 5..231 9..244
AalteGPx01 304 6.27e-106 1..233 1..240
PnoGPx 303 1.47e-105 1..229 1..219
ClunGPx01 300 3.22e-105 66..230 1..166
Gene structure Fichier Exons


exon

Literature and cross-references LfluGPx01
DNA ref. JGI genome:   scaffold_8 (1327674..1328440)
Cluster/Prediction ref. JGI gene:   416190
Protein sequence: LfluGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232 (301)
PWM (Da):   %s   25989.7 (31587.6)  
PI (pH):   %s   10.28 (5.35) Peptide Signal:   %s   cut: 34 range:34-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIRRLCTAPLRVAPQSKQISHHRVNRLIAQRPQPTALFFTLTKSTPLQLSALPIQTRELRASFATMASATTFFDFKPKDKKGSEFDLAGLKGKVVLVVNTASKCGFTPQFEGLEKLYKDT
KATHPDFEILGFPCNQFGGQDPGSNDEIQNFCQVNYGVTFPVLGKIDVNGDSADPVFEWLKKEKPGVMGLKRVKWNFEKFLVGRDGKVKQRWASTTKPESLKAEIEKELAKK*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
CDS
Send to BLAST