Entry information : DexiGPx01
Entry ID 12247
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: DexiGPx01
Name DexiGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Didymellaceae Didymella
Organism Didymella exigua    [TaxId: 100019 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DexiGPx01
start..stop
S start..stop
Ssrc1lsm3aGPx01 300 1.98e-106 1..167 1..167
AalteGPx01 300 2.23e-105 1..169 72..240
CberGPx01 296 7.21e-105 1..168 1..168
ClunGPx01 295 1.83e-104 1..165 1..165
Gene structure Fichier Exons


exon

Literature and cross-references DexiGPx01
DNA ref. JGI genome:   scaffold_16 (654973..654329)
Cluster/Prediction ref. JGI gene:   93128
Protein sequence: DexiGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18674.51  
PI (pH):   %s   8.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFFDFKPKDKKGTDYPLSNLSGKVVLVVNTASKCGFTPQFAGLEKLYKELKGQYGDQVEFLGFPCNQFGGQDPGSNDQIQEFCQLNYGVSFPVLGKIDVNGDKADPAFEWLKNEK
PGLMGMKRVKWNFEKFLVGKDGKVKGRWASTKKPEDLKADIVKELEGK*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
CDS
Send to BLAST