1. Browse the Database
  2. View Redoxidase
Entry information : DcryGPx01
Entry ID 12283
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: DcryGPx01
Name DcryGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3005]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Dioszegia
Organism Dioszegia cryoxerica    [TaxId: 603311 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DcryGPx01
start..stop		 S start..stop
CnGPx01_H99 281 2.26e-99 1..152 1..152
CgaGPx01 281 2.63e-99 1..151 1..151
CnGPx01_JEC21 280 4.22e-99 1..151 1..151
TmesGPx01_Fries 259 5.75e-91 1..151 1..151
Gene structure Fichier Exons►


exon

Literature and cross-references DcryGPx01
DNA ref. JGI genome:   scaffold_99 (48043..47242)
Cluster/Prediction ref. JGI gene:   282087
Protein sequence: DcryGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   151 (380)
PWM (Da):   %s   17024.63 (40595.6)  
PI (pH):   %s   6.25 (6.50) Peptide Signal:   %s   cut: 20 range:20-399
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDIYSHTVELPKSSLPLAEYKDRTLLFVNVASKCGLTPQYKDLQALHEKYSDKGLVIIGFPCNQFKAQEPGTDDEVLQFCQMNYGVTFPIAKKGDVNGEDTQPIWKYLKTHAEPPVQDI
DWNFSKFLVKNGKVTFFPARTTKVSDVEAAL*

Retrieve as FASTA  
Remarks complete sequence from genomics (6 introns)
DNA ►
Send to BLAST
CDS►
Send to BLAST