Entry information : DcryGPx03
Entry ID 12285
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: DcryGPx03
Name DcryGPx03
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Dioszegia
Organism Dioszegia cryoxerica    [TaxId: 603311 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DcryGPx03
start..stop
S start..stop
DcryGPx02 376 6.07e-136 1..185 1..185
CgaGPx02 280 6.22e-98 7..183 11..185
CnGPx02_JEC21 276 1.31e-96 7..183 11..185
CnGPx02_grubiiH99 274 1.09e-95 7..183 11..185
Gene structure Fichier Exons


exon

Literature and cross-references DcryGPx03
DNA ref. JGI genome:   scaffold_90 (31486..32327)
Cluster/Prediction ref. JGI gene:   341176
Protein sequence: DcryGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   184
PWM (Da):   %s   19850  
PI (pH):   %s   6.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNYINILGFETVPASAKGKSFYDLKASLPGSKGDYDFANLKGKAVLIVNTASKCGFTPQYTGLEELHKTYLDKGLEVLGFPSNEFGGQDPGTDDEIASFCQVNHGVTFPLMKKSEVNGNN
MNDVFAWLKANGAEVAGAGGVAGTTSIKWNFTKFLVDRNGHVVGRYSPSTKPETLKAEIEKLLQ*

Retrieve as FASTA  
Remarks complete sequence from genomics (3 introns)
DNA
Send to BLAST
CDS
Send to BLAST