Entry information : SsteGPx01
Entry ID 12340
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2017-04-20 (Catherine Mathe (Scipio))
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteGPx01
Name SsteGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteGPx01
start..stop
S start..stop
RrubGPx02 140 9.5e-45 1..80 1..80
BaGPx01 132 5.06e-41 1..79 55..133
PcroGPx01 132 5.54e-41 1..80 62..141
PgigGPx01 132 7.52e-41 4..79 59..134
Gene structure Fichier Exons


exon

Literature and cross-references SsteGPx01
DNA ref. JGI genome:   scaffold_13 (1600096..1600497)
Cluster/Prediction ref. JGI gene:   91203
Protein sequence: SsteGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   80 (337)
PWM (Da):   %s   8800.43 (35676.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.55 (4.17) Peptide Signal:   %s   cut: 21 range:21-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKFYELKADKPDGSKLDFSELKGKVVLIVNVASQCGFTKQYGLQALYNKYKEKDFVILGFPCNFGGQEKGSDDEIAE

Retrieve as FASTA  
Remarks incorrect sequence from genomics (3 introns). 3'end missing
DNA
Send to BLAST
CDS
Send to BLAST