Entry information : GrPrx05
Entry ID 13424
Creation 2015-08-11 (Christophe Dunand)
Last sequence changes 2015-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-09 (Achraf Jemmat)
Peroxidase information: GrPrx05
Name GrPrx05
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Malvaceae Gossypium
Organism Gossypium raimondii    [TaxId: 29730 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GrPrx05
start..stop
S start..stop
GrPrx03 620 0 1..326 1..332
GrPrx04 567 0 2..325 10..333
RcPrx17 553 0 5..325 8..331
CpapPrx44 550 0 5..326 8..332
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13424' 'join(97..303,395..586,663..828,901..1313)' Exons


exon

Literature and cross-references GrPrx05
Literature Paterson,A.H. et al., Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature 492 (7429), 423-427 (2012)
Protein ref. GenBank:   KJB40465.1
DNA ref. GenBank:   NC_026935.1 (4579530..4580746) Phytozome 12:   Chr07 (4579530..4580773)
mRNA ref. GenBank:   XM_012632739.1
Cluster/Prediction ref. Phytozome Gene 12:   26782836
Protein sequence: GrPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (309)
PWM (Da):   %s   35962.23 (34280.2) Transmb domain:   %s   i2-24o
PI (pH):   %s   8.96 (9.08) Peptide Signal:   %s   cut: 17 range:17-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVCSIIVITLLALGLASNIIGGYLYPQFYDHSCPRAQEIVRNVVAKAVAKEPRMAASLLRLHFHDCFVKGCDASILLDSGGSIISEKKSNSNRNSARGFEVMDEIKAVIEKECPHTVSCA
DILALAARDSTVLTGGPSWEVPLGRRDSRGASLSCSNNNVPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGFARCTRFRERLYNQSGNGKPDNTLDQSYASQLRRNCPRSGGDQNQF
FLDFVSPIKFDNSYFKNLMANKGLLNSDQVLFTKNGESRELVKTYAYNQELFFQQFAKSMIKMGNISPLTGYRGEIRQDCRKINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns).
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST