Entry information : HaPrx75 (HanXRQChr10g0294991)
| Entry ID | 13629 |
|---|---|
| Creation | 2016-05-02 (Christophe Dunand) |
| Last sequence changes | 2016-05-02 (Christophe Dunand) |
| Sequence status | complete |
| Reviewer | Not yet reviewed |
| Last annotation changes | 2017-11-23 (Catherine Mathe (Scipio)) |
Peroxidase information: HaPrx75 (HanXRQChr10g0294991)
| Name (synonym) | HaPrx75 (HanXRQChr10g0294991) | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Class | Class III peroxidase [Orthogroup: Prx027] | ||||||||||||||||||||||||||||||||||||
| Taxonomy | Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus | ||||||||||||||||||||||||||||||||||||
| Organism | Helianthus annuus (Sunflower) [TaxId: 4232 ] | ||||||||||||||||||||||||||||||||||||
| Cellular localisation | N/D |
||||||||||||||||||||||||||||||||||||
| Tissue type | N/D |
||||||||||||||||||||||||||||||||||||
| Inducer | N/D |
||||||||||||||||||||||||||||||||||||
| Repressor | N/D |
||||||||||||||||||||||||||||||||||||
| Best BLASTp hits |
|
||||||||||||||||||||||||||||||||||||
| Gene structure Fichier |
Exons►
|
||||||||||||||||||||||||||||||||||||
Literature and cross-references HaPrx75 (HanXRQChr10g0294991)
| DNA ref. | HanXRQ genome: HanXRQChr10 (109826836..109830253) |
|---|
Protein sequence: HaPrx75 (HanXRQChr10g0294991)
| Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
| Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
| Remarks | partial sequence from genomic (part of PS is missing : MAYLKNLCSLFYHLLLLAFILTNNVNADGLK found with frame shift) | ||||||||||||
| DNA ► Send to BLAST |
|
||||||||||||
| CDS► Send to BLAST |
|
||||||||||||
| cDNA► Send to BLAST |
|
||||||||||||
