Entry information : HaPrx75 (HanXRQChr10g0294991)
Entry ID | 13629 |
---|---|
Creation | 2016-05-02 (Christophe Dunand) |
Last sequence changes | 2016-05-02 (Christophe Dunand) |
Sequence status | complete |
Reviewer | Not yet reviewed |
Last annotation changes | 2017-11-23 (Catherine Mathe (Scipio)) |
Peroxidase information: HaPrx75 (HanXRQChr10g0294991)
Name (synonym) | HaPrx75 (HanXRQChr10g0294991) | ||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Class | Class III peroxidase [Orthogroup: Prx027] | ||||||||||||||||||||||||||||||||||||
Taxonomy | Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus | ||||||||||||||||||||||||||||||||||||
Organism | Helianthus annuus (Sunflower) [TaxId: 4232 ] | ||||||||||||||||||||||||||||||||||||
Cellular localisation | N/D |
||||||||||||||||||||||||||||||||||||
Tissue type | N/D |
||||||||||||||||||||||||||||||||||||
Inducer | N/D |
||||||||||||||||||||||||||||||||||||
Repressor | N/D |
||||||||||||||||||||||||||||||||||||
Best BLASTp hits |
|
||||||||||||||||||||||||||||||||||||
Gene structure Fichier |
Exons►
![]() |
Literature and cross-references HaPrx75 (HanXRQChr10g0294991)
DNA ref. | HanXRQ genome: HanXRQChr10 (109826836..109830253) |
---|
Protein sequence: HaPrx75 (HanXRQChr10g0294991)
Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
Remarks | partial sequence from genomic (part of PS is missing : MAYLKNLCSLFYHLLLLAFILTNNVNADGLK found with frame shift) | ||||||||||||
DNA ► Send to BLAST |
|
||||||||||||
CDS► Send to BLAST |
|
||||||||||||
cDNA► Send to BLAST |
|