1. Browse the Database
  2. View Redoxidase
Entry information : HaKat[P]03 (HanXRQChr04g0096431)
Entry ID 13669
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaKat[P]03 (HanXRQChr04g0096431)
Name (synonym) HaKat[P]03 (HanXRQChr04g0096431)
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaKat[P]03
start..stop		 S start..stop
HaKat04 146 3.09e-43 52..124 420..492
HaKat05 143 4.22e-42 52..124 420..492
HaKat08 128 2.66e-36 52..124 430..502
EcamKat13 107 7.47e-32 39..120 17..99
Gene structure Fichier Exons►


exon

Literature and cross-references HaKat[P]03 (HanXRQChr04g0096431)
DNA ref. HanXRQ genome:   HanXRQChr04 (8407648..8410739)
Protein sequence: HaKat[P]03 (HanXRQChr04g0096431)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   124
PWM (Da):   %s   14572.38  
PI (pH):   %s   9.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTAWGFRSKQPCGNLAKCFKEVKDDVFQGDDGYPLKACYPLMLHVFFKFLETVIPKYNDFKQPGDRYRSWDLARQERFIVRMCKILSDPRVTHELRSIWISYWTAYQSLGQKIASRLNVH
PNY

Retrieve as FASTA  
Remarks Pseudogene from genomic (first 420 aa are missing)
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST