Entry information : CsPrx36 (orange1.1g020143m/Cs6g04560)
Entry ID 1370
Creation 2007-09-10 (Christophe Dunand)
Last sequence changes 2015-04-13 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx36 (orange1.1g020143m/Cs6g04560)
Name (synonym) CsPrx36 (orange1.1g020143m/Cs6g04560)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx36
start..stop
S start..stop
CclPrx33 683 0 1..330 1..330
CsPrx04 540 0 1..329 1..327
PtPrx08 536 0 25..329 25..329
PtrePrx03 526 0 25..329 24..328
Gene structure Fichier Exons


exon

Literature and cross-references CsPrx36 (orange1.1g020143m/Cs6g04560)
Literature Bausher,M., Shatters,R., Chaparro,J., Dang,P., Hunter,W. and Niedz,R. An expressed sequence tag (EST) set from Citrus sinensis L. Osbeck whole seedlings and the implications of further perennial source investigations. Plant Sci. 165, 415-422 (2003).
DNA ref. Citrus sinensis Annotation Project:   chr6 (5447041..5449145) Phytozome 12:   scaffold00282 (159380..157387)
EST ref. GenBank:   BQ623981  DN620459.1 [3' end]
Protein sequence: CsPrx36 (orange1.1g020143m/Cs6g04560)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (301)
PWM (Da):   %s   36840.67 (33415.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.22 (6.50) Peptide Signal:   %s   cut: 32 range:30-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATTKRLRFHLSPSFFFLLLPLLLQFYSGMSELQFNYYAQSCPKAEEIIKQQVVQLYYKHGNTAVSWVRNLFHDCAVSCDASLLLETVTGVASEQASERSFGMRNFKYVSTIKAALEAECPLKVSCADIVALSAREGIVMLGGPRIPIKTGRRDSRVSYLAEVEKFIPN
HNDSIATALSVFNSIGIDDEGVVALY
GAHSVGRVHCVNLVHRLYPTVDPTLDPVYAEYLKGRCPTPDPDPDAVVYARNDRETPMILDNNYYKNIINHKGLLIVDQQLASDPRTTPFVQKM
AANNSYFHEQFSRAIALLSENNPLTGDQGEVRKDCRYVNI

Retrieve as FASTA  
Remarks Complete sequence from genomic and 5 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST