1. Browse the Database
  2. View Redoxidase
Entry information : CbraPrxII02 (g61495.t1/ CHBRA86g00400)
Entry ID 13837
Creation 2016-07-28 (Christophe Dunand)
Last sequence changes 2016-07-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-07-28 (Christophe Dunand)
Peroxidase information: CbraPrxII02 (g61495.t1/ CHBRA86g00400)
Name (synonym) CbraPrxII02 (g61495.t1/ CHBRA86g00400)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Charophyceae Characeae Chara
Organism Chara braunii    [TaxId: 69332 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CbraPrxII02
start..stop		 S start..stop
MsPrxII02 144 3.72e-45 1..142 1..162
MtPrxII02 144 3.83e-45 1..142 1..162
PmaPrxII03 144 4.1e-45 1..142 1..162
SpolPrxII01 142 1.33e-44 1..142 1..162
Gene structure Fichier Exons►


exon

Literature and cross-references CbraPrxII02 (g61495.t1/ CHBRA86g00400)
Protein sequence: CbraPrxII02 (g61495.t1/ CHBRA86g00400)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   149
PWM (Da):   %s   16008.22  
PI (pH):   %s   4.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPVALGDKIPAVKLAYMDSTNTKHVFDTCADKKHVPDFIQRADDLQAKGVDGIYCVSVNDVFVMKAWEATFPIDGKLQMLADGNGDFAEALGIQLDLKEFGLGLRSKRFALVTVDGVVK
ILNVEEGGEYTKSGPETILKAIEGGALEA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_86, 2 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST