Entry information : PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Entry ID 13918
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Name (synonym) PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaCSD04
start..stop
S start..stop
PpaCSD03 385 4.48e-139 1..205 1..207
LeCSD03 273 3e-94 25..205 33..218
HaCSD04 271 1.28e-93 22..204 37..225
NoffCSD02-1B 270 1.67e-93 1..204 1..207
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13918' 'complement(join(284702..284727,284923..284976,285135..285242,285378..285473,285766..285805,286088..286149,286400..286628))' Exons


exon

Literature and cross-references PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Cluster/Prediction ref. Genebank:   5934138 [Incorrect prediction]
Protein sequence: PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   204 (329)
PWM (Da):   %s   20649.49 (35850.4)  
PI (pH):   %s   6.07 (9.45) Peptide Signal:   %s   cut: 29 range:29-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATTMSTLSTSLVAPTVAASQSAFQGASVRVNLMPAVGVVKSRPLTIVAATKKAVAVLKGNANVEGVVTLLQEDDGPTKVNVKITGLAPGKHGFHLHEFGDTTNGCMSTGPHFNPEGKT
HGAPEDQNRHAGDLGNVIAGDDGVVEVTLEDSQIPLSGPNSVVGRAFVIHEAEDDLGKGGHELSSTTGNAGGRLACGVVGLTPL*

Retrieve as FASTA  
Remarks (Chromo 9, 6 introns)
DNA
Send to BLAST
CDS
Send to BLAST