1. Browse the Database
  2. View Redoxidase
Entry information : HaGrxC04(HanXRQChr05g0145251)
Entry ID 14408
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-02-03 (Catherine )
Peroxidase information: HaGrxC04(HanXRQChr05g0145251)
Name HaGrxC04(HanXRQChr05g0145251)
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC04
start..stop		 S start..stop
HaGrxC01 196 1.51e-67 1..97 1..97
HaGrxC17 194 5.64e-67 1..97 1..97
HaGrxC19 192 7.7e-66 1..97 1..97
HaGrxC11 180 4.08e-61 9..97 5..93
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14408' 'join(129226785..129226804,129226868..129226956,129227050..129227148,129227230..129227315)' Exons►


exon

Literature and cross-references HaGrxC04(HanXRQChr05g0145251)
Protein sequence: HaGrxC04(HanXRQChr05g0145251)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   97 (122)
PWM (Da):   %s   10402.26 (12895.4) Transmb domain:   %s   i13-35o
PI (pH):   %s   6.5 (7.44) Peptide Signal:   %s   cut: 31 range:27-148
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQSYLSCKTWCGYCKSVKKLFSELNVSYKVIELDESDGGEIQSTLKEWTGQSIVPNVFIGGKHIGGSDAIMEKHRAGKLVLLLTEAGAIANASAQL

Retrieve as FASTA  
Remarks
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST