1. Browse the Database
  2. View Redoxidase
Entry information : EferPrx78(Eurfer_26_g17263)
Entry ID 16822
Creation 2020-12-12 (Christophe Dunand)
Last sequence changes 2020-12-17 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2021-05-07 (Christophe Dunand)
Peroxidase information: EferPrx78(Eurfer_26_g17263)
Name EferPrx78(Eurfer_26_g17263)
Class Class III peroxidase    [Orthogroup: Prx058]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Basal Magnoliophyta
Organism Euryale ferox    [TaxId: 4414 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EferPrx78
start..stop		 S start..stop
EferPrx125 558 0 7..327 21..312
EferPrx91 548 0 7..327 21..331
EferPrx81 494 6.45e-178 2..327 18..314
EferPrx111 492 3.09e-177 2..327 18..314
Literature and cross-references EferPrx78(Eurfer_26_g17263)
Protein sequence: EferPrx78(Eurfer_26_g17263)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328
PWM (Da):   %s   35819.77  
PI (pH):   %s   4.74
Sequence
Send to BLAST
Send to Peroxiscan
*.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
SLLLATSFAQ LTPDFYSESC PGVFSAVHSQ IEIALEKEKR MGAWLVRMFF HDFFVNGCDG FILLDDTPTF VGEKKGGPNM NSVRGFEVID AIKAAVEEVC PGVVSCADII AIAARDSVLG  LGGPSWDVKL GRRDARTASQ ALANTSIPAP TSNLTQLISS FAVQGLSVRD MVALSGTVAN TFKRIRIHEN TLSVSHIIIV ELEAGAHTIG QARCTTFRNH IYKEINIDGF FAGTRQAYCP 
PSNGTDDNNL APLDINTPNF FDNSYYKDLI AKRGLLHSDQ ELFNDGSTDS QVWEYSENPD TFYADFMAAM IKMGDIKPLT GYDGEVRS* 

Retrieve as FASTA  
Remarks Incorrect prediction, contains two Prx ORF and two extra exons in 5'. one without start and one partial (last exon, AGVHTIGERRCTNFRNYMYNESNVDGFFARTRRGKCPPTKGSGDNNLAPLDINTMNFFDNSYYKNLIAKRSLLHSDQELFNGGSTNSQVESYASNPFAFNADFVAAVIRMGDIKPLTGNNGEIRKNCRRVN*). Eurfer_26_1311344_1328361_g17263.t1_-1_CDS_2836157588_8187
DNA ►
Send to BLAST