Entry information : InPrx[P]50
| Entry ID | 17408 |
|---|---|
| Creation | 2022-04-22 (Christophe Dunand) |
| Last sequence changes | 2022-04-22 (Christophe Dunand) |
| Sequence status | theoretical translation / pseudogene |
| Reviewer | Not yet reviewed |
| Last annotation changes | 2022-05-04 (Christophe Dunand) |
Peroxidase information: InPrx[P]50
| Name | InPrx[P]50 | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Class | Class III peroxidase [Orthogroup: N/D] N/D | |||||||||||||||||||||||||
| Taxonomy | Eukaryota Viridiplantae Streptophyta Convolvulaceae Ipomoea | |||||||||||||||||||||||||
| Organism | Ipomoea nil [TaxId: 35883 ] | |||||||||||||||||||||||||
| Cellular localisation | N/D |
|||||||||||||||||||||||||
| Tissue type | N/D |
|||||||||||||||||||||||||
| Inducer | N/D |
|||||||||||||||||||||||||
| Repressor | N/D |
|||||||||||||||||||||||||
| Best BLASTp hits |
|
Literature and cross-references InPrx[P]50
| Protein ref. | GenBank: XP_019197371.1 |
|---|
Protein sequence: InPrx[P]50
| Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
| Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
| Remarks | Pseudogene, exon 4 is missing. Also contains just at the end of the sequence and in reverse QGCDGSILLDSTPTNKAEKDAIPNQSLAGYDVIDEIKVRLEEECWGVVSCADILALVARDSVSFQFKMPMWLVPLGRMDGNISRDFEAWSLLPSSFSNFSTLLRNFASRGLDVHDLVVLSG and a second part of the exon 1 |
||||||||||||
