Entry information : InPrx[P]50
Entry ID | 17408 |
---|---|
Creation | 2022-04-22 (Christophe Dunand) |
Last sequence changes | 2022-04-22 (Christophe Dunand) |
Sequence status | theoretical translation / pseudogene |
Reviewer | Not yet reviewed |
Last annotation changes | 2022-05-04 (Christophe Dunand) |
Peroxidase information: InPrx[P]50
Name | InPrx[P]50 | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Class | Class III peroxidase [Orthogroup: N/D] N/D | |||||||||||||||||||||||||
Taxonomy | Eukaryota Viridiplantae Streptophyta Convolvulaceae Ipomoea | |||||||||||||||||||||||||
Organism | Ipomoea nil [TaxId: 35883 ] | |||||||||||||||||||||||||
Cellular localisation | N/D |
|||||||||||||||||||||||||
Tissue type | N/D |
|||||||||||||||||||||||||
Inducer | N/D |
|||||||||||||||||||||||||
Repressor | N/D |
|||||||||||||||||||||||||
Best BLASTp hits |
|
Literature and cross-references InPrx[P]50
Protein ref. | GenBank: XP_019197371.1 |
---|
Protein sequence: InPrx[P]50
Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
Remarks | Pseudogene, exon 4 is missing. Also contains just at the end of the sequence and in reverse QGCDGSILLDSTPTNKAEKDAIPNQSLAGYDVIDEIKVRLEEECWGVVSCADILALVARDSVSFQFKMPMWLVPLGRMDGNISRDFEAWSLLPSSFSNFSTLLRNFASRGLDVHDLVVLSG and a second part of the exon 1 |