1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx40(At4g16270 / PER40 / AtperoxP40)
Entry ID 206
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2020-03-04 (Christophe Dunand)
Peroxidase information: AtPrx40(At4g16270 / PER40 / AtperoxP40)
Name AtPrx40(At4g16270 / PER40 / AtperoxP40)
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Inflorescences
Siliques
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx40
start..stop		 S start..stop
AlyPrx40 720 0 1..362 1..362
AhalPrx40 714 0 1..362 1..362
BstrPrx61 688 0 1..362 1..362
NoffPrx40-1A 673 0 1..362 1..362
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx40(At4g16270 / PER40 / AtperoxP40)
Literature REFERENCE 1 Tsukagoshi H, Busch W, Benfey PN. Transcriptional regulation of ROS controls transition from proliferation to differentiation in the root. Cell. 2010 Nov 12;143(4):606-16.
REFERENCE 2 Jacobowitz JR, Doyle WC, Weng JK. PRX9 and PRX40 Are Extensin Peroxidases Essential for Maintaining Tapetum and Microspore Cell Wall Integrity during Arabidopsis Anther Development. Plant Cell. 2019 Apr;31(4):848-861.
Protein ref. UniProtKB:   O23474
DNA ref. Phytozome 12:   Chr4 (9205038..9206483)
mRNA ref. GenBank:   NM_117724
Cluster/Prediction ref. Phytozome Gene 12:   19647397 UniGene:   At.50347
Omic ref. ePlant:   At4g16270 TAIR:   At4g16270
Protein sequence: AtPrx40(At4g16270 / PER40 / AtperoxP40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362 (329)
PWM (Da):   %s   39088.19 (35017.0) Transmb domain:   %s   i17-34o (i17-34o)
PI (pH):   %s   4.42 (4.18) Peptide Signal:   %s   cut: 34 range:34-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLKLRRKWSDHITTMKNLFNLFLMFFFAMPILSLSENPTNFSESC
EDGSGETGSSFGIGFDLVLDFGLYRNSCPEAESIVYSWVETTVLEDPRMAASLLRLHFHDCFVNGCDASVLLDDTEGLVGEKTAPPNLNSLRGFEVIDSIKSDIESVCPETVSCADILAMAARDSVVVSGGPRWEVEVGRKDSRTASKQAATNGLPSPNSTVSTLISTFQNLGLSQTDMVALSG
GHTLGKARCTSFTARLQPLQTGQPANHGDNLEFLESLQQLCSTVGPSVGITQLDLVTPSTFDNQYYVNLLSGEGLLPSDQALAVQDPGTRAIVETYATDQSVFFEDFKNAMVKMGGIPGG
SNSEIRKNCRMIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns), 6 cDNA and 4 ESTs. Related to flowers
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST