1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx52 (At5g05340 / PER52 / AtperoxP52 / ATP49)
Entry ID 218
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-18 (Christophe Dunand)
Peroxidase information: AtPrx52 (At5g05340 / PER52 / AtperoxP52 / ATP49)
Name (synonym) AtPrx52 (At5g05340 / PER52 / AtperoxP52 / ATP49)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Mixed tissues
Siliques
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx52
start..stop		 S start..stop
AlyPrx52 640 0 1..324 1..324
AhalPrx44 639 0 1..324 1..324
BstrPrx47 623 0 1..324 1..324
AruPrx52 617 0 1..324 1..324
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx52 (At5g05340 / PER52 / AtperoxP52 / ATP49)
Literature REFERENCE 1 Herrero J, Esteban Carrasco A, Zapata JM Arabidopsis thaliana peroxidases involved in lignin biosynthesis: in silico promoter analysis and hormonal regulation.
Plant Physiol Biochem. 2014;80:192-202

REFERENCE 2 Fernández-Pérez F, Pomar F, Pedreño MA, Novo-Uzal E. The suppression of AtPrx52 affects fibers but not xylem lignification in Arabidopsis by altering the proportion of syringyl units. Physiol Plant. 2015;154(3):395-406
Protein ref. UniProtKB:   Q9FLC0
DNA ref. Phytozome 12:   Chr5 (1580819..1579142)
mRNA ref. GenBank:   NM_120616
Cluster/Prediction ref. Phytozome Gene 12:   19665519 UniGene:   At.28537
Omic ref. AtProteome:   At5g05340 ATTED-II:   At5g05340 e-FP Browser:   At5g05340 ePlant:   At5g05340 Genevestigator:   At5g05340 TAIR:   At5g05340
Protein sequence: AtPrx52 (At5g05340 / PER52 / AtperoxP52 / ATP49)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (296)
PWM (Da):   %s   34079.97 (31069.3)  
PI (pH):   %s   8.4 (8.58) Peptide Signal:   %s   cut: 29 range:29-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNKLISILVLVVTLLLQGDNNYVVEAQLTTNFYSTSCPNLLST
VQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSG
AHTIGQSRCTNFRARIYNETNINAAFATTRQRTCPRASGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLHSDQVLFNGGSTDSIVRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGE
IRKVCGRTN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns), 2 cDNA and 4 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST