1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx61 (At5g24070 / PER61 / AtperoxP61)
Entry ID 227
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx61 (At5g24070 / PER61 / AtperoxP61)
Name (synonym) AtPrx61 (At5g24070 / PER61 / AtperoxP61)
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx61
start..stop		 S start..stop
AlyPrx61 685 0 2..340 3..341
BstrPrx68 672 0 1..340 2..341
TsPrx61 651 0 2..340 3..341
CrubPrx58 641 0 1..340 1..340
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx61 (At5g24070 / PER61 / AtperoxP61)
Protein ref. UniProtKB:   Q9FLV5
DNA ref. Phytozome 12:   Chr5 (8135991..8134301)
mRNA ref. GenBank:   NM_122312
Cluster/Prediction ref. Phytozome Gene 12:   19671237 UniGene:   At.54966
Omic ref. AtProteome:   At5g24070 ATTED-II:   At5g24070 e-FP Browser:   At5g24070 ePlant:   At5g24070 Genevestigator:   At5g24070 RnR:   At5g24070 TAIR:   At5g24070
Protein sequence: AtPrx61 (At5g24070 / PER61 / AtperoxP61)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (315)
PWM (Da):   %s   37217.67 (34558.2)  
PI (pH):   %s   7.36 (7.36) Peptide Signal:   %s   cut: 26 range:26-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQFVNFFPLLALVVISLAGKATVEAATGLNPPVKLVWHYYKLTNT
CDDAETYIRYQVEKFYKNDSSIAPKLLRLLYSDCMVNGCDGSILLQGPNSERTAPQNRGLGGFVIIDKIKQVLESRCPGVVSCADILNLATRDAVHMAGAPSYPVFTGRRDGGTLNADAVDLPSPSISVDESLAYFKSKGLDVLDMTTLLGAHSMGK
THCSYVVDRLYNFKNTGKPDPTMNTTLVSQLRYLCPPRTQKGQTDPLVYLNPDSGSSNRFTSSYYSRVLSHNAVLRVDQELLNNDDSKEITQEFASGFEDFRKSFALAMSRMGSINVLTG
TAGEIRRDCRVTNANDGA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns). No EST. Containing motif 'YSDC'.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST