1. Browse the Database
  2. View Redoxidase
Entry information : PpaPrx10
Entry ID 250
Creation 2008-08-07 (Christophe Dunand)
Last sequence changes 2008-08-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx10
Name PpaPrx10
Class Class III peroxidase    [Orthogroup: Prx192]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx10
start..stop		 S start..stop
PpaPrx03 428 9.1e-152 21..328 14..325
PpaPrx16 421 4.98e-149 1..328 1..325
PpaPrx08 358 4.88e-124 16..328 8..321
MpPrx174 305 2.59e-103 19..328 11..325
Gene structure Fichier Exons►


exon

Literature and cross-references PpaPrx10
Literature www.cosmoss.org
(search by Penel lab)
DNA ref. Phytozome 12:   scaffold_201 (153966..155249)
EST ref. GenBank:   BJ183104 [5' end]  BJ588402 [3' end]
Protein sequence: PpaPrx10
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (293)
PWM (Da):   %s   35948.93 (31840.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.73 (6.50) Peptide Signal:   %s   cut: 36 range:36-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERRCKHLHWKAFLVTTPALLWFAMLLVAMRLSSAEPLRVGYYDL
SCPSAERIIRQAMERGMQQDQGIAAGVLRLHFHDCFVEGCDGSVLLDNPNSEKTSPPNFSLRGFEVVDAAKADLEALCPGVVSCADILAFGARDAVELMGGLGWRVRAGRYDGRVSSAARALAEIPDPRYTVEEITALFARKGLSKSDMIVLSGAHTI
GRAHCASVTPRLYPVQDPQMSQAMAAFLRTACPPQGGSAATFSLDSTTPYRFDNMYYTNLIANRGLLHSDQALINDMSTRGETIFNSFAAGPWAFQFSRVMIEMGNIQVKSGPDGEIRRH
CRFIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 3 ESTs (No overlap between the 5' and 3' clones). Ecotype="Gransden 2004".
DNA ►
Send to BLAST
CDS►
Send to BLAST