1. Browse the Database
  2. View Redoxidase
Entry information : SbPrx56 (Sobic.003G140200.1 [2.1] / SB03G011950 [1.4])
Entry ID 2705
Creation 2006-01-12 (Christophe Dunand)
Last sequence changes 2006-01-12 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx56 (Sobic.003G140200.1 [2.1] / SB03G011950 [1.4])
Name (synonym) SbPrx56 (Sobic.003G140200.1 [2.1] / SB03G011950 [1.4])
Class Class III peroxidase    [Orthogroup: Prx217]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx56
start..stop		 S start..stop
ZmPrx121 599 0 1..334 1..333
SiPrx24 516 0 24..334 22..311
TaPrx131-1A 508 0 31..334 28..330
OsPrx06 503 0 19..334 15..336
Gene structure Fichier Exons►


exon

Literature and cross-references SbPrx56 (Sobic.003G140200.1 [2.1] / SB03G011950 [1.4])
Literature PlantGDB
DNA ref. Phytozome 12:   chromosome_3 (13687296..13686169)
Protein sequence: SbPrx56 (Sobic.003G140200.1 [2.1] / SB03G011950 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (301)
PWM (Da):   %s   36468.6 (33007.8)  
PI (pH):   %s   10.22 (9.83) Peptide Signal:   %s   cut: 34 range:34-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRGSSSSTRVAQLAALTTLLSWSWIVVSSVASSELQVGYYSRSC
PRAEDLIRNVVHAAIRRDPGNGPGLVRLFFHDCFVRGCDASVLLDAAPGSNASTVEKASQANNPSLRGFSVISRAKRVLERRCRRTVSCADIVAFAARDACGLMGGVDFAVPAGRRDGRVSNASEVLNSLPGPFANARKLVDSFAAKNLTADDMVT
LSGAHSFGRSHCSALSFRLYPQLAEDMNATYGRYLRTRCPAATGRRDRVVDLDPRTELRLDNQYYRNVQTREVLFTSDVTLLSRNDTAALVDLYARNRTLWASRFASAMVKMGHLDVLTG
TQGEIRKFCNRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1). No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST