Entry information : MtPrx90 (Medtr5g014100.1[4.0]Medtr5g014100.1[3.5] / Medtr5g014310.1[3.0])
Entry ID 2809
Creation 2006-08-28 (Christophe Dunand)
Last sequence changes 2011-07-13 (Qiang Li)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx90 (Medtr5g014100.1[4.0]Medtr5g014100.1[3.5] / Medtr5g014310.1[3.0])
Name (synonym) MtPrx90 (Medtr5g014100.1[4.0]Medtr5g014100.1[3.5] / Medtr5g014310.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx043]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Mycorrhizal roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx90
start..stop
S start..stop
GmPrx105 600 0 1..333 1..333
PpePrx23 504 0 5..333 3..334
PtPrx83 501 2.15e-180 19..331 27..337
VvPrx15 489 1.01e-175 1..332 1..332
Gene structure Fichier Exons


exon

Literature and cross-references MtPrx90 (Medtr5g014100.1[4.0]Medtr5g014100.1[3.5] / Medtr5g014310.1[3.0])
Literature Shaull,S., Lin,S., Dixon,R., May,G., Sumner,L., Gonzales,B., Cook,D., Kim,D. and Roe,B.A. Medicago truncatula BAC Clone mth2-28p22
DNA ref. Phytozome 12:   chr5 (4681854..4683565)
Cluster/Prediction ref. Phytozome Gene 12:   31088527
Protein sequence: MtPrx90 (Medtr5g014100.1[4.0]Medtr5g014100.1[3.5] / Medtr5g014310.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (310)
PWM (Da):   %s   37737.54 (35130.0)  
PI (pH):   %s   8 (7.75) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEPLRLLLILITILSNIHTLRGSELLVHEYYKEKCPLAEDIVRHNVAVAVLKDPRLAASLLRLHFHDCFVMGCDASVLLDSVEGMTSEKQAGPNVNSLRGFEVIDKIKYLLEKECPLTVS
CADILAMVARDAVELRGGPRWEVWLGRKDSLESSFSGANLFIPAPNSSLETLINNFKQQGLDIEDLVVLSGSHTIGRARCLSFRQRIYETKQEYHHAYDRYKRYTTFRRILQSICPVTGR
DDKFAPLDFQTPKRFDNQYFINIIEGKGLLGSDNVLISQDLDGRIRKQVWGYASNEKLFFDSFAKSMIKMGNINVLTGSEGEIRRNCRFVNP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns) and 1 EST (AJ502451). No DAS in the Swiss-Prot link.
DNA
Send to BLAST
CDS
Send to BLAST