Entry information : PtPrx10 (POPTR_0012s00700 / PT12G03470 / Potri.012G006800)
Entry ID 3088
Creation 2008-08-18 (Christophe Dunand)
Last sequence changes 2014-01-07 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2014-01-07 (Qiang Li)
Peroxidase information: PtPrx10 (POPTR_0012s00700 / PT12G03470 / Potri.012G006800)
Name (synonym) PtPrx10 (POPTR_0012s00700 / PT12G03470 / Potri.012G006800)
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx10
start..stop
S start..stop
PatrPrx10 608 0 1..321 1..329
PtPrx89 510 0 1..321 2..329
PtPrx90 453 7.07e-162 2..321 1..330
PnPrx90 452 1.17e-161 2..321 1..329
Gene structure Fichier Exons


exon

Literature and cross-references PtPrx10 (POPTR_0012s00700 / PT12G03470 / Potri.012G006800)
Literature DOE joint genome institute contig.
DNA ref. Phytozome 12:   scaffold_12 (391139..392451)
Omic ref. ePlant:   Potri.012G006800
Protein sequence: PtPrx10 (POPTR_0012s00700 / PT12G03470 / Potri.012G006800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (295)
PWM (Da):   %s   35219.47 (32306.0)  
PI (pH):   %s   8.09 (7.73) Peptide Signal:   %s   cut: 27 range:27-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSSKKLTQLCVTFWVAVLFCQSVQSHLQVGFYRNSCGRAESIVRRCWLDRGVAAGLVRLHFHDCFVRxLRLDSTSSNKAEKHSTANYPSLRGFEVIDDAKARLEAECQGVVSCADILAF
AARDSFDLVTGGFDYDVQAGRRDGIVSLASETYSNLPPPTFNVDQLTQRFSDKGLTQEEMVTLSGAHTIGNSHCRSFTYRLYNFSGTNSQDPSLDSQYAASLRKSCPQDSTDPNLEVPMD
TRTPTISDVNYYKDILANRGLFSSDQILLTNPATASEVKSNARSPSGWKKKFAAAMVKMGQIEVLTGNKGEIRANCRVINS

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic (3 introns). No EST. Two frame shift in frame. GCEGSC (start of exon 2) is missing.
DNA
Send to BLAST