Entry information : MtPrx67 ( Medtr4g083710.1[4.0] / Medtr4g083710[3.5] / Medtr4g114950.1[3.0] / MT4G083710)
Entry ID 392
Creation 2009-01-02 (Christophe Dunand)
Last sequence changes 2016-04-07 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: MtPrx67 ( Medtr4g083710.1[4.0] / Medtr4g083710[3.5] / Medtr4g114950.1[3.0] / MT4G083710)
Name (synonym) MtPrx67 ( Medtr4g083710.1[4.0] / Medtr4g083710[3.5] / Medtr4g114950.1[3.0] / MT4G083710)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Glandular trichome
Leaves
Inducers Pathogen interaction
Phoma infection
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx67
start..stop
S start..stop
MtPrx110 577 0 4..325 1..322
MtPrx76 574 0 4..324 1..320
GmPrx53 558 0 4..324 1..323
GmPrx209 549 0 4..325 1..324
Gene structure Fichier Exons


exon

Literature and cross-references MtPrx67 ( Medtr4g083710.1[4.0] / Medtr4g083710[3.5] / Medtr4g114950.1[3.0] / MT4G083710)
Literature Watson,B.S. et al., unpublished
Protein ref. UniProtKB:   G7JIS0
DNA ref. Phytozome 12:   chr4 (32493314..32494592)
EST ref. GenBank:   BF646967 [5' end]
Cluster/Prediction ref. Phytozome Gene 12:   31111428 UniGene:   Mtr.20196
Omic ref. Gene atlas:   Mtr.33223.1.S1_at  Mtr.33223.1.S1_x_at
Protein sequence: MtPrx67 ( Medtr4g083710.1[4.0] / Medtr4g083710[3.5] / Medtr4g114950.1[3.0] / MT4G083710)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (299)
PWM (Da):   %s   34801.6 (31922.1)  
PI (pH):   %s   8.32 (8.40) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHSMAFRIMISFVVTLVLLSSICDAQLSSTFYDSTCPNALSTIRTVIRTAVSKERRMAASLIRLHFHDCFVQGCDASILLDDTSTIESEKSALPNINSVRGFEVIDKAKANVEKVCPGVV
SCADIVAVAARDASFAVGGPSWTVKLGRRDSTVASKSQANSDLPKFTDDLTTLIAHFTNKGLTLKDMVTLSGAHTIGQAQCFTFRDRIYNNASDIDAGFASTRRRGCPSLSSTTNNQKLA
ALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFGGGGSTDSIVSEYSKNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRSICSAIN*

Retrieve as FASTA  
Remarks Complete sequence from 3 ESTs (GE347114, EX526950, BF646967) and genomic (chromo 4 and 3 introns).

DNA
Send to BLAST
CDS
Send to BLAST