Entry information : AtAPx07 (At4g09010 / APX4 / THYLAKOID_LUMEN 29 / TL29)
Entry ID 3920
Creation 2006-09-08 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-15 (Christophe Dunand)
Peroxidase information: AtAPx07 (At4g09010 / APX4 / THYLAKOID_LUMEN 29 / TL29)
Name (synonym) AtAPx07 (At4g09010 / APX4 / THYLAKOID_LUMEN 29 / TL29)
Class Ascorbate peroxidase    [Orthogroup: APx2004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation Thylakoid lumen
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtAPx07
start..stop
S start..stop
BstrAPx07 673 0 1..349 1..348
NoffAPx07-1A 659 0 1..349 1..347
CrubAPx07 657 0 1..349 1..344
NoffAPx07-1B 656 0 1..349 1..347
Gene structure Fichier Exons


exon

Literature and cross-references AtAPx07 (At4g09010 / APX4 / THYLAKOID_LUMEN 29 / TL29)
Literature REFERENCE 1 Spiegel,L.A., Huang,E.N., Nascimento,L.U., de la Bastide,M., Vil,D.M., Preston,R.R., Matero,A., Shah,R., O'Shaughnessy,A., Rodriguez,M., Shekher,M., Schutz,K., See,L.H., Swaby,I., Habermann,K., Dedhia,N.N., Mewes,H.W., Lemcke,K. and Mayer,K.F.X. Unpublished
REFERENCE 2 Robben,J., Grymonprez,B., Bastiaens,I., Volckaert,G., Mewes,H.W., Lemcke,K. and Mayer,K.F.X. Unpublished
REFERENCE 3
Lamar,B., Stoneking,T., Stumpf,J., Mewes,H.W., Lemcke,K. and Mayer,K.F.X. Unpublishe (16-APR-2005)
Protein ref. UniProtKB:   P82281
DNA ref. Phytozome 12:   Chr4 (5779338..5777502)
Cluster/Prediction ref. Phytozome Gene 12:   19647518
Omic ref. AtProteome:   At4g09010 ATTED-II:   At4g09010 e-FP Browser:   At4g09010 ePlant:   At4g09010 TAIR:   At4g09010
Protein sequence: AtAPx07 (At4g09010 / APX4 / THYLAKOID_LUMEN 29 / TL29)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349
PWM (Da):   %s   37797.46 Transmb domain:   %s   i7-26o
PI (pH):   %s   8.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGGVSFLSTVPSFTNTTNHQHLTTLSSSSHRSAVIRCSKIEPQVSGESLAFHRRDVLKLAGTAVGMELIGNGFINNVGDAKAADLNQRRQRSEFQSKIKILLSTTIKAKPELVPSLLKLA
LNDAMTYD
ATKSGGANGSIRFSSELSRAENEGLSDGLSLIEEVKKEIDSISKGGPISYADIIQLGQSAVKFTYLASAIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSDATEADPEG
RVPQWGKATVQEMKDKFIAVGLGPR
LAVMSAFLGPDQAATEQLLATDPQVAPWVQKYQRSRETVSQTDYEVDLITAFTKLSCLGQQINFEAYTYPVERINLSKLKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA and 15 ESTs (TIGR, UniGene At.22637). According to Teixeira FK et al. (J.Mol.Evol. (2004) pp. 761-770), it is not an APx, as it lacks heme-binding site, active site and is more distant to other APx proteins than CCP.
Promoter
Send to BLAST
Send to cis Analysis
Terminator +
Send to BLAST
Send to cis Analysis
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST