Entry information : CgPrxII_CBS14851
Entry ID 4687
Creation 2007-02-16 (Christophe Dunand)
Last sequence changes 2012-04-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-19 (Christophe Dunand)
Peroxidase information: CgPrxII_CBS14851
Name CgPrxII_CBS14851
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgPrxII_CBS14851
start..stop
S start..stop
CgPrxII 322 5.92e-115 1..166 1..166
NcPrxII-B 250 9.76e-87 1..166 1..166
VdaPrxII01 232 1.55e-79 3..166 2..166
MgrPrxII 201 1.96e-67 1..166 1..168
Gene structure Fichier Exons


exon

Literature and cross-references CgPrxII_CBS14851
Literature Birren,B et al., The Broad Institute Genome Sequencing Platform. Annotation of the Chaetomium globosum CBS 148.51 Genome
Protein ref. UniProtKB:   Q2H4X6
DNA ref. JGI genome:   scaffold_3 (3043047..3042423)
Protein sequence: CgPrxII_CBS14851
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   17305.7  
PI (pH):   %s   5.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATLQAGSSFPEGVSFSYIPPTGNLDVTVCGIPTTYDASKDFQTHKVVLVAVPGAFTPTCQEQHIVSYLSHLAELKAKGVDKVIFIASNDAFVMSAWGKANGIKDESILFMSDGGAAFSR
SIGWASADRTGRYAVVVDHGKVIYAEADTTKGSIAHSGAEGVLAKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 exons). Strain="CBS 148.51". Homology with PrxII but only one cystein.
DNA
Send to BLAST
CDS
Send to BLAST