Entry information : AniKat02 (AniKatT / catC)
Entry ID 5252
Creation 2007-04-17 (Marcel Zamocky)
Last sequence changes 2007-04-17 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AniKat02 (AniKatT / catC)
Name (synonym) AniKat02 (AniKatT / catC)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425 ]
Cellular localisation Peroxisomal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniKat02
start..stop
S start..stop
AnKat03 928 0 1..501 1..501
AorKat03 911 0 1..501 1..501
CimKat02 902 0 1..498 1..499
PEchKat02 890 0 1..497 1..496
Gene structure Fichier Exons


exon

Literature and cross-references AniKat02 (AniKatT / catC)
Literature REFERENCE 1 Galagan J.E., et al., "Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae.";
Nature 438:1105-1115(2005).
REFERENCE 2 Kawasaki,L. and Aguirre,J. Multiple catalase genes are differentially regulated in Aspergillus nidulans J. Bacteriol. 183 (4), 1434-1440 (2001)
Protein ref. UniProtKB:   Q5B0L2
DNA ref. JGI genome:   ChrI_A_nidulans_FGSC_A4 (1817926..1816321)
Protein sequence: AniKat02 (AniKatT / catC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   501 (47)
PWM (Da):   %s   56986.1 (5239.6)  
PI (pH):   %s   7.99 (8.25) Peptide Signal:   %s   cut: 23 range:23-69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGQNDDQKTYRYNESPVYTTSNGCVMDPQASQRVGPNGPLLLQDFNLn>IDLLAHFDRERIPERVVHAKGAGAYGEFEVTDDISDITVIDMLKGVGKKTKTFVRFSTVGGEKGSPDSARDPRGFACKFYTEEGNWDWVFNNTPVFF
LRDPSKFPMFIHTQKRN
PQTNLKDATMFWDYLSTHQEAVHQVMHLFSDRGTPYSYRHMNGYSGHTYKWIKPDGTFNYVQLHLKTDQGNKTFTDAEATRLAAENPDWHTQDLFNAIARGEYPSWTCYVQTLSPEQAEK
FRWNIFDLTKVWPQSEVPLRRFGRFTLNKNPENYFAEVEQAAFSPSHLVPGVEPSADPVLQARLFSYPDTHRHRLGTSNYQSIPVNCPLRAFTPFHRDGAMSVNGNHGANPNYPSTFRPL
QYKPVKASQEHEKWAGSVVTEQLPVTDEDFVQANGLWKVLGRQPGQQENFVGNVAGHLCNAHPRVRQATYGMFRRVNADLGKRIEKATEKKATEARARL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo I, 2 introns). Strain="FGSC A4".
DNA
Send to BLAST
CDS
Send to BLAST