Entry information : OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE)
Entry ID | 5569 |
---|---|
Creation | 2007-07-23 (Christophe Dunand) |
Last sequence changes | 2010-08-06 (Christophe Dunand) |
Sequence status | complete |
Reviewer | Not yet reviewed |
Last annotation changes | 2022-02-28 (Christophe Dunand) |
Peroxidase information: OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE)
Name | OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Class | Respiratory burst oxidase homolog [Orthogroup: Rboh002] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Taxonomy | Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism | Oryza sativa ssp japonica cv Nipponbare [TaxId: 39947 ] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Cellular localisation | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Tissue types | Inflorescences Leaves Stems Whole plant |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Inducer | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Repressor | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Best BLASTp hits |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene structure Fichier |
Exons►
![]() |
Literature and cross-references OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE)
Literature | Sasaki T., Matsumoto T., Yamamoto K. Oryza sativa nipponbare(GA3)genomic DNA, chromosome 8, PAC clone:P0048G02. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases. |
---|---|
Protein ref. | UniProtKB: B8BBA2 [Incorrect splicing] Q0J595 [Incorrect splicing] Q6ZAG4 [Incorrect splicing] |
DNA ref. | GenBank: NC_008401.2 (22203440..22212265) |
Cluster/Prediction ref. | UniGene: Os.5679 |
Protein sequence: OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE)
Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
Remarks | Complete sequence from genomic (chromo 8, 13 introns), 2 mRNA and 12 ESTs. Incorrect prediction from Phytozome (splicing errors: missing exons and extra exon). Three SwissProt/TREMBL accessions: none are completly correct: Q0J595 (uncorrect splicing prediction), A3BTR7 (differential splicing prediction, shorter sequence), Q6ZAG4 (differential splicing prediction, shorter sequence). ESTs for the 3'end do not allow to confirm one prediction. The two following parts have been removed form the predicted sequence (Q0J595): (KQAKPSSMSMARRARARSRDDTAYGAGIGAG)(KVESSSGFKWAPPGRSNQCSVAGEPAGTEDPRPGRLRVKAPVIQKSPRPTGLPLSCGA) and (QISDQSFDARLQIFFDMVDTNVDGRITREEVQEL)has been added. |
||||||||||||
DNA ► Send to BLAST |
|
||||||||||||
CDS► Send to BLAST |
|