1. Browse the Database
  2. View Redoxidase
Entry information : MgrGPx
Entry ID 5587
Creation 2007-07-24 (Christophe Dunand)
Last sequence changes 2011-11-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: MgrGPx
Name MgrGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Magnaporthaceae Magnaporthe
Organism Magnaporthe grisea (Pyricularia grisea)    [TaxId: 148305 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MgrGPx
start..stop		 S start..stop
CgraGPx01 306 7.79e-108 1..166 69..234
ChigGPx01 304 9.11e-107 1..165 73..237
CgloGPx01_ST23 300 1.75e-106 1..166 1..166
CfioGPx01_MH18 301 1.24e-105 1..166 74..239
Gene structure Fichier Exons►


exon

Literature and cross-references MgrGPx
Literature Dean RA, et al., The genome sequence of the rice blast fungus Magnaporthe grisea. Nature 434:980-986(2005).
Protein ref. GenPept:   EDK01077 UniProtKB:   A4R9V7
DNA ref. JGI genome:   Supercontig_6.20 (741931..741023)
Cluster/Prediction ref. UniGene:   Mgr.794
Protein sequence: MgrGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172 (277)
PWM (Da):   %s   19185.81 (29548.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.02 (8.98) Peptide Signal:   %s   cut: 19 range:19-295
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATTIYDFKPLNKKGEETPLADYKGKVVLVVNTASKCGFTPQY
AGLEALYKKITEKHPEDFTILGFPCNQFGGQEPGTDDDIQNFCQVNYGVTFPIMKKVDVNGDNADPLFKWLKEEMPGIMGLKRVKWNFE
KFLIGRDGKVKGRWASTTKPESLEKDI
LKEIEAPKPSI

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 3, 1 intron) and 7 ESTs. Strain="70-15/ FGSC 8958".
DNA ►
Send to BLAST
CDS►
Send to BLAST