Entry information : MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
Entry ID 5701
Creation 2008-12-29 (Christophe Dunand)
Last sequence changes 2014-07-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-31 (Christophe Dunand)
Peroxidase information: MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
Name (synonym) MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
Class Plant glutathione peroxidase     [Orthogroup: Gpx2002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Seedling roots
Inducer Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtGPx04
start..stop
S start..stop
MtGPx05 266 8.16e-93 1..168 1..167
EgrGPx09 259 4.08e-90 1..168 1..167
EguGPx09 259 5.25e-90 1..168 1..167
GhGPx05 256 3.78e-89 1..170 1..169
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '5701' 'complement(join(32217099..32217134,32217248..32217418,32217613..32217731,32217852..32217913,32218031..32218107,32218326..32218379))' Exons


exon

Literature and cross-references MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
DNA ref. GenBank:   AC158374.1 (11983..13676) Phytozome 12:   chr1 (32218379..32217099)
EST ref. GenBank:   BF004012 [3' end]  BF004318 [3' end]
Cluster/Prediction ref. Phytozome Gene 12:   31099129
Protein sequence: MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   19408.16  
PI (pH):   %s   9.72
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGATQSVLENSIHEYKVKDARGKEVNLGIYRGKVLLVVNVASKCNFADANYTQLTQLYTKYKEGLEILGFPCNQFLRKEPGTSQEAQDFACDRYKAEYPILGIRVNGQDTAPVYKYLKSQ
KCGSLGSRRIKWNFTKFLVDEEGRVIQRYSPTTQPLAIE
NDIKKALRVAN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo1, 5 introns) and 2 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST