1. Browse the Database
  2. View Redoxidase
Entry information : HsLPO-B
Entry ID 5813
Creation 2007-09-21 (Marcel Zamocky)
Last sequence changes 2010-12-03 (Myriam Duval (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-05-11 (Christophe Dunand)
Peroxidase information: HsLPO-B
Name HsLPO-B
Class Lactoperoxidase    [Orthogroup: LPO001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Homo
Organism Homo sapiens (human)    [TaxId: 9606 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsLPO-B
start..stop		 S start..stop
HsLPO 1272 0 18..629 101..712
HsLPO 50 0.00000189 1..38 1..38
PtroLPO 1267 0 18..629 101..712
PtroLPO 50 0.00000187 1..38 1..38
MmulLPO-B 1246 0 18..629 101..712
MmulLPO-B 47 0.0000227 1..38 1..38
PpyLPO 1246 0 18..629 101..712
PpyLPO 48 0.0000101 1..38 1..38
Gene structure Fichier Exons►


exon

Literature and cross-references HsLPO-B
Literature Conner,G.E., Fragoso,M.A. and Torbati,A. Regulation of lactoperoxidase expression. Unpublished in May 2007
Protein ref. GenBank:   ABQ53140.1
DNA ref. GenBank:   NC_000017.1 (56320341..56345355)
mRNA ref. GenBank:   EF579964 (1..2160)
EST ref. GenBank:   DC385493 [5' end]
Protein sequence: HsLPO-B
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   629 (608)
PWM (Da):   %s   70824.87 (68616.5)  
PI (pH):   %s   7.59 (7.39) Peptide Signal:   %s   cut: 22 range:22-629
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVLLHLPALLASLILLQAAASTTRDPSLDLTSLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTPGKTRNGFPLPAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVDHDLD
FAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINALTSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSK
KPSPCEFINTTARVPCFLAGDSRASEHILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAFVIITFRDYLPILLGDHMQKWIPPYQGYSESVDPRISNVFTFAFRFGHLE
VPSSMFRLDENYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQPTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKS
KMLAKKLLGLYGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTNEQKDSLQKMSFSRLVCDNTRITKVPRDPFWANSYPYDFVDCSAIDKLDLSPWASV
KN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 17, 9 introns). Lactoperoxidase splicing variant (prediction). Confirmed by ESTs. ESTs from the two variants are compiled in the same unigene.
DNA ►
Send to BLAST
CDS►
Send to BLAST