1. Browse the Database
  2. View Redoxidase
Entry information : SsclDyPrx
Entry ID 5890
Creation 2007-10-22 (Christophe Dunand)
Last sequence changes 2007-10-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-27 (Catherine Mathe (Scipio))
Peroxidase information: SsclDyPrx
Name SsclDyPrx
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Sclerotinia
Organism Sclerotinia sclerotiorum    [TaxId: 5180 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsclDyPrx
start..stop		 S start..stop
BfuDyPrx 803 0 1..510 1..513
NcDyPrx 775 0 1..510 1..513
SmaDyPrx 774 0 1..510 1..513
NtetDyPrx01_2508 773 0 1..510 1..513
Gene structure Fichier Exons►


exon

Literature and cross-references SsclDyPrx
Literature The Broad Institute Genome Sequencing Platform. Birren B., et al., Annotation of the Sclerotinia sclerotiorum 1980 genome.
Protein ref. GenPept:   EDN98532 UniProtKB:   A7F711
DNA ref. JGI genome:   Supercontig_2.25 (38790..36906)
Protein sequence: SsclDyPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   514 (286)
PWM (Da):   %s   58515.66 (32026.2)  
PI (pH):   %s   7.28 (8.49) Peptide Signal:   %s   cut: 0 range:Ymax-285
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWIARKSNIQGDIMSWIARKSNIQGDIWPGLPKRFQTFLFFKIKKPDEFKQRLRSFAKNITTANDVCVMKDQISAAKLEAQKLRQSAKTLALPGVNIAFASTGLALGKFSFKDAEVKRNQEFYTKFKNNQLRGGLFRKGMYDDLVNE
GWDNPEEIRDEYSPSKHWIDGVFLVTASLQGALENQVNRVKEHFLKVDGRGDANNYEISNDPAIEFIFDKQGKTRPEKGKEHFGFEDGISQPLIEGLDEVTPKDKEPKSVKSGLIFAKHP
GDKMKQPDWAEDGSFLVFRDLQQLVPEFDKWLEDNKEHAPNAKMSEDPKEKLAAYLMGRWKGTPVDENPHDDKDKNLFRSNNFDFHPIENHDKCPFAAHIRKMRPRGDLDHDHTVIIRRS
ISYGDEVTPKEELEQKSDDKKQRGLLFVCYQSDIREGFNFLTTRWASSHHFPDGKGKFVGEHGPGIDAIVGQRQACHPPRSIGLPDGKVPTEARLQLEQWVIHRGGEYFFSPSIKALEGY
LTDGPDYPPEITAPRPLI

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST