Entry information : LbiGPx
Entry ID 6525
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2012-04-06 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-23 (Christophe Dunand)
Peroxidase information: LbiGPx
Name LbiGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiGPx
start..stop
S start..stop
LameGPx01 321 1.54e-114 1..161 32..192
HcyGPx01 291 2.31e-102 1..161 48..208
GmarGPx02 288 5.05e-101 1..161 53..213
GsppGPx01 285 1.08e-99 1..161 73..233
Gene structure Fichier Exons


exon

Literature and cross-references LbiGPx
Protein ref. UniProtKB:   B0DA76
DNA ref. JGI genome:   LG_3 (3563555..3562911)
Protein sequence: LbiGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   161 (300)
PWM (Da):   %s   18141.11 (32665.9)  
PI (pH):   %s   5.35 (8.86) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDSGFYSLKAERPGGKEYSFSELKGKVVLIVNVASKCGFTPQYKGLQDLYLKYKDQNFVILGFPCNFGGQEPEDDKGIEEFCTLNHGVTFPLMKKSDVNGDNTNEVYKWLKEEKSGIFGLTRIKWNFEKFLVDKEGNVVQRWASTTTPQAIDEEVA
KLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTs (EX794785, EL739305).
DNA
Send to BLAST
CDS
Send to BLAST