Entry information : MmulGPx07
Entry ID 6577
Creation 2009-02-05 (Christophe Dunand)
Last sequence changes 2009-02-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-11-22 (Myriam Duval (Scipio))
Peroxidase information: MmulGPx07
Name MmulGPx07
Class Animal glutathione peroxidase    [Orthogroup: Gpx1005]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cercopithecidae Macaca
Organism Macaca mulatta (rhesus monkey)    [TaxId: 9544 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MmulGPx07
start..stop
S start..stop
PtroGPx07 374 3.28e-135 4..184 7..187
HsGPx07 374 3.28e-135 4..184 7..187
SscGPx07 350 9.73e-126 17..184 19..186
MmGPx07 350 1.05e-125 1..184 1..186
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6577' 'join(55441937..55442065,55446471..55446732,55448376..55448539)' Exons


exon

Literature and cross-references MmulGPx07
DNA ref. GenBank:   NC_007858.1 (55441937..55448539)
Cluster/Prediction ref. UniGene:   Mmu.2353
Protein sequence: MmulGPx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   184 (168)
PWM (Da):   %s   20697.63 (19056.8)  
PI (pH):   %s   9.41 (9.63) Peptide Signal:   %s   cut: 17 range:17-184
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAAAAWLLLWAVACAQREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVE
EVRPQITALVRKLILRKREDL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns). No EST. Incorrect gene prediction (=>XM_001105729.1).
DNA
Send to BLAST
CDS
Send to BLAST