Entry information : MmulGPx01
Entry ID 6578
Creation 2009-02-05 (Christophe Dunand)
Last sequence changes 2010-11-23 (Myriam Duval)
Sequence status complete
Reviewer Myriam Duval
Last annotation changes 2010-11-23 (Myriam Duval)
Peroxidase information: MmulGPx01
Name MmulGPx01
Class Animal glutathione peroxidase    [Orthogroup: Gpx1003]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cercopithecidae Macaca
Organism Macaca mulatta (rhesus monkey)    [TaxId: 9544 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MmulGPx01
start..stop
S start..stop
MnemGPx01 407 7.45e-148 1..198 1..198
MfGPx01 401 2.88e-145 1..198 1..201
PtroGPx01-A 398 2.64e-144 1..198 1..201
HsGPx01-A 398 3.27e-144 1..198 1..203
Gene structure Fichier Exons


exon

Literature and cross-references MmulGPx01
DNA ref. GenBank:   NC_007859.1 (87082497..87083340)
Protein sequence: MmulGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   198
PWM (Da):   %s   21394.93  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MCAARLAAAAVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPL
FAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPVRRYSRRFQTIDIEPDIEALLSQGPSSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 1 intron). Isolate="17573".
DNA
Send to BLAST
CDS
Send to BLAST